KEGG   Salinispora arenicola: Sare_2384Help
Entry
Sare_2384         CDS       T00613                                 

Definition
(GenBank) D-Lysine 56-aminomutase alpha subunit
  KO
K01844  
beta-lysine 5,6-aminomutase alpha subunit [EC:5.4.3.3]
Organism
saq  Salinispora arenicola
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:saq00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Sare_2384
Enzymes [BR:saq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.3  lysine 5,6-aminomutase
     Sare_2384
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2739691..2741253
Genome map
AA seq 520 aa AA seqDB search
MTGKLDLDPVLVARARALAARAGAPVVELARSHTTVSVERAVLRLAGVQGADPDGIPWVN
RLVDAVVADVGLGHGVAVPVFDALAREQMADVTLLAQKAAAGSVRFEVPVGRAATAARRA
ARRAVAAGVRRIDRRRVERERLVRRFGDPARRPWIYLIVATGDIYEDIPQAQAAARAGAD
AIAVIRSTGQSLLDYVPEGATREGFAGTYATQENFRLMRAALDESSRELGRYVRLTNYAS
GLCMPEMAALAGLERLDMMLNDSMYGILFRDINPIRTFVDQRFSRQVHARAGIIINTGED
NYLTTADAVDEAHTVTVSQLLNEFFAHEAGLADWQLGLGHAFEINPDVPESLRLELAHAL
LARELFPDAPLKWMPPTKHMTGDVFRGNLLDGFFNLVGALTGQGILLVGMMTEAVVTPWL
SDRDIALQNVRYVLGAAGGLHEDFVPASGGFIQQRAHQVLGSAVELLERIGEQSLLTAIG
EGTFGIMKRPADRGKGLDGVARHEGDYYNPAVEILEGVGS
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgggaagcttgatctggatccggtgttggtggcgcgggcgcgggcgttggctgcc
cgggctggggcaccggtggtggagttggcgcgtagccacacgacggtgtcggtggagcgg
gcggtgctgcggttggccggggtgcagggtgcggatccggatggtattccgtgggtgaac
cggctggtggatgcggtggtggcggatgtggggttggggcatggtgtggcggtgccggtg
tttgatgctctggcgcgggagcagatggcggatgtgacgttgctggcgcagaaggcggcg
gccgggtcggtgcggttcgaggtgccggtggggcgggcggcgacggctgcgcggcgggct
gcgcggcgggcggtcgcggcgggggtgcggcgtatcgatcggcggcgggtcgagcgggag
cggttggtgcggcggttcggggatccggcgcggcggccgtggatctatctgatcgtggcg
acgggggacatctacgaggacattccgcaggcgcaggcggcggccagggcgggggcggat
gcgattgcggtgattcggtcgacggggcagtcgttgttggactacgtgccggagggggcg
actcgggagggtttcgcgggcacgtatgcgacgcaggagaacttccggttgatgcgggcg
gcgttggacgagtcgtcgcgggagttgggccggtatgtgcggttgacgaactacgcgtcg
gggctgtgtatgccggagatggcggcgttggctggcctggagcggctggacatgatgttg
aacgactcgatgtatgggatcttgtttcgggacatcaacccgatccgtacgttcgttgat
cagcggttctcccgacaggtgcacgcgcgggcggggatcatcatcaatacgggtgaggac
aattacctgacgaccgccgatgcggtggacgaggcgcacacggtgacggtgtcgcagttg
ctcaacgagttcttcgcgcatgaggcggggttggctgactggcagttggggttggggcac
gcgttcgagatcaacccggatgtgccggagtcgttgcggttggagttggcgcacgccttg
ctggcgcgggagttgtttccggatgcgccgctgaagtggatgccgccgacgaagcacatg
acgggggacgtgtttcgcggcaacctgctcgacgggttcttcaacctggtgggggcgctg
accgggcaggggattctgttggtggggatgatgaccgaggcggtggtgacgccgtggttg
tcggatcgggacatcgcgttgcagaacgtccggtatgtgttgggcgccgcgggcgggttg
cacgaggatttcgtacctgcgtcaggcgggttcattcagcagcgggcgcatcaggtgctg
ggttcggcggtggagttgctggagcggatcggggagcagtcgttgttgacggcgatcggc
gagggcacgttcgggatcatgaagcggccggcggaccggggtaaggggctggatggggtg
gcgcggcacgagggcgactactacaacccggcggtggagatcttggagggggtggggtcg
tga

DBGET integrated database retrieval system