KEGG   Salinispora arenicola: Sare_2386Help
Entry
Sare_2386         CDS       T00613                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K18014  
3-aminobutyryl-CoA ammonia-lyase [EC:4.3.1.14]
Organism
saq  Salinispora arenicola
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:saq00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Sare_2386
Enzymes [BR:saq01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.14  3-aminobutyryl-CoA ammonia-lyase
     Sare_2386
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2742011..2742403
Genome map
AA seq 130 aa AA seqDB search
MTDPRVGLTVTHRRYVSYSHAHYAGSLVDGAYALGLFGDVATEVCIRTDGDEGLFAGYAD
VRFVAPVRAGDVVEVTGRVSRVGTRSRTLELSCVVVCRGRPDRGESAAQVCDPPIVAVTA
TGTVVVPPVA
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgacggacccgagggtcgggttgacggtgacgcaccgacggtatgtgtcgtattcgcac
gcgcactacgcgggcagcctggtcgacggggcgtacgcgttgggtttgttcggggacgtc
gcgacggaggtgtgtatccgcaccgacggggacgaggggttgttcgccgggtacgccgac
gtgcggttcgtcgcgccggtgcgggccggtgacgtggtggaggtgaccggtcgggtcagc
cgggtgggtacgcgtagccgcacgctggagctgagctgtgtggtggtgtgtcggggtcga
ccggatcggggggagtccgcggcgcaggtgtgtgatccgccgattgtggcggtcaccgcg
acgggcacggtggtcgtgccgccggtggcgtga

DBGET integrated database retrieval system