KEGG   Salinispora arenicola: Sare_2387Help
Entry
Sare_2387         CDS       T00613                                 

Definition
(GenBank) conserved hypothetical protein
Organism
saq  Salinispora arenicola
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2742400..2743737
Genome map
AA seq 445 aa AA seqDB search
MNVAVCADVGSTYTKVAVVDLDGAGLVAAAAVPTTVDSDVLRGLDAAVAAATAGLRAREA
PWYVCSSAGGGLRLAVVGYEHLVTAQAGRRVGLSAGANVVHVAAGRLGAAGLAAVRAARP
DVLLLVGGTDGGDAETLTHNATRLARARWRVPVVLAGNADVREDLRGLLVSAGVPVTVAE
NVLPRIGVSAPAGARAAIREVFLRHVIGGKRLSRGQRFPRLVRAATPDAVLTGVELLADT
LGGDLVVVDVGGATTDVYSVLTPDERETGPGREVAGSLWRARTVEGDLGVRWSAPGVVRA
AVEERLLDAGDAEALAVAARRRAEDPGYLPVRESERAADARIGALAATVALRRHARGAAT
GERAGRDLRDVRLLVGSGGVLRHAAPADAVGMLAGVLADHGGGWPLPRAARPVVDVDYVL
AAAGLLAGEHPVAARALTAPLRAGG
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgtcgcggtctgcgcggacgtcggttcgacgtacacgaaggtggcggtggtcgat
ctcgacggtgcgggtctggtcgcggcggcggccgtgccgaccaccgtggacagcgacgtg
ttacgggggttggatgcggcggtcgccgccgcgacagccggcctgcgggcgcgggaggcc
ccgtggtacgtgtgttcgtcggcggggggtgggctgcggctggcggttgtcggctacgag
catctggtgaccgcgcaggcgggccgtcgggtgggcctgtcggcgggggcgaacgtggtg
cacgtggccgcggggcggctcggcgcggcggggctggcggcggtgcgggcggcccgtccg
gatgtgctgctgctggtcggtggtactgatggcggtgacgcggagacgttgacccacaac
gcgacgcggctggcgcgggcccgctggcgggtgccggtggtcctcgccggtaacgcggac
gtccgtgaggacctgcgtggcctgctggtgtcagccggggtgccggtgaccgtggcggag
aatgtgctgccccggatcggggtgtcggcgccggccggggcgcgggcggcgatccgggag
gtgttcctgcggcatgtgatcggcgggaaacggctgtcccgggggcagcggtttccgcgg
ctggtgcgggcggccacgccggacgcggtgctgaccggggtggaactgctcgctgacacg
ctcggtggtgacctggtggtggttgacgtcggtggggcgaccaccgacgtgtactcggtg
ttgaccccggacgaacgggagaccgggccggggcgggaggtggctggcagcctgtggcgg
gcccgcaccgtcgaaggggacctgggggtgcggtggagcgcgccaggtgtggtgcgggcg
gcggtggaggagcggctgctcgacgcgggtgacgccgaggcgttggcggtggcggcgcgg
cgtcgtgccgaggatccgggataccttccggtgcgggagtccgagcgggcggcagacgcg
cggatcggtgcgttggcggccacggtggcgttgcgccggcatgcccgtggggcggccacg
ggtgaacgtgccggtcgggacctgcgggacgtgcggctcctggtcggttcgggtggggtg
ctgcggcacgccgcgcccgctgacgccgtggggatgctcgcgggggtactcgccgaccac
gggggtggctggccgttgccgcgtgccgcccggccggtggtcgacgtcgactacgtgctc
gccgccgccgggctactcgcgggggagcatccggttgcggcgcgtgcgctcaccgccccg
ctgcgcgcgggaggctag

DBGET integrated database retrieval system