KEGG   Salinispora arenicola: Sare_2410Help
Entry
Sare_2410         CDS       T00613                                 

Definition
glycoside hydrolase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
saq  Salinispora arenicola
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:saq00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2775135..2776514
Genome map
AA seq 459 aa AA seqDB search
MKLGVRIAALVGVVAVTAAGAMVATATATAAASPTATFVKVSDWGTGWEGRYTITNGGSS
TLNSWQVEFDLPTGTTVGSYWNALMNHDGQHYRFTNQHWNGTITPGASVTFGFLGAGSGS
PSGCRLNGQPCTPTAPPTTSPPPTTAPPSTTPVAANGQLRVCGQRLCNEDGKQIQLRGMS
THGLQWYANCANTASLDVLAQEWGADVLRISMYIQEGGYETDPRRFTDLVHDYIELATAR
GLYAVVDWHMLTPGDPNYNLSRARTFFAEIADRHRDKVNVLYEIANEPNGVSWGAIKSYA
DQVIPVIRERDPEAVVLVGTPDWSSLGVSGSGGGVDAILADPVAASNLMYVFHFYAASHG
DPYYNTLADAADRLPIFVTEFGTQQYTGDGPNNFTMSQRYLDLMANKKISWVNWNYSDDF
RSGAVFTTGTCAAGEFSGTGPLKPAGGWIRERMRTADDF
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgggcgtgagaattgcggccctggtcggcgtcgtcgcggtgacagctgcgggg
gccatggtggccaccgcgaccgcgaccgcagcggcctcgccgaccgcgacgttcgtcaag
gtttccgactggggcaccggctgggagggtcggtacaccatcaccaacgggggaagcagc
accctgaactcctggcaggtcgagtttgacctaccgacgggcaccaccgtcggttcgtac
tggaacgcgctgatgaaccacgatgggcagcactaccgcttcaccaaccagcactggaac
ggcacgatcacgccgggcgcctcggtgacgttcggcttcctcggtgccggctccggcagt
ccgagcggttgccggctcaacggacagccgtgcacaccaacagctcctccgacgacgagt
ccgccaccgaccaccgcgccccccagcaccacgccggttgcagcgaacgggcagttgcgg
gtctgcggacagcgcctctgtaacgaggacggcaagcagatccaactccggggcatgagc
acgcacggactccagtggtacgccaactgcgcgaacacggcctcgctcgacgtactcgcc
caggagtggggtgcggacgttctgcgaatctcgatgtacatccaggaaggcggctacgaa
actgacccgcgccgattcaccgacctggtccacgactacatcgaactggccaccgcccgc
ggcctctacgcggtcgtcgactggcacatgctcacccctggagacccgaactacaacctc
tcgcgagcgcgaaccttcttcgcggagatcgccgaccgccaccgggacaaggtcaacgtc
ctgtacgagatcgcgaacgaaccgaacggtgtcagttggggagccatcaagagctacgcc
gaccaggtaatcccggtcatccgggaacgggatccggaagccgtggtgcttgtcggcaca
cccgactggtcgtcgctcggtgtgtctggcagtggcggcggcgtcgatgccatcctcgcc
gatccggtggcagcgagcaatctcatgtacgtcttccacttctacgcggcatcacacggc
gacccgtactacaacaccttggccgacgcggccgaccggcttccgatctttgtgaccgag
ttcggaacccagcagtacaccggcgacggcccgaacaacttcaccatgtcccagcgctac
ctcgacctcatggcgaacaagaagatcagttgggtcaactggaactactccgacgacttc
cgctctggcgcggtcttcacgactggcacgtgcgccgccggcgagttcagcggtacgggc
cccctcaaaccggccggcggttggatacgcgaacgcatgcgtaccgcggacgacttctga

DBGET integrated database retrieval system