KEGG   Salinispora arenicola: Sare_2421Help
Entry
Sare_2421         CDS       T00613                                 

Definition
(GenBank) transcriptional regulator, MerR family
Organism
saq  Salinispora arenicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MerR_1 MerR HTH_17 HTH_Tnp_1 YdaS_antitoxin HTH_3 AbiEi_4 HTH_28 HTH_31
Motif
Other DBs
NCBI-ProteinID: ABV98277
JGI: Sare2421
UniProt: A8M315
Position
2787257..2787985
Genome map
AA seq 242 aa AA seqDB search
MYRPVDLARTHGLSAQAVRNYEQAGMIPPAARTASGYRVYTDNHVGALAAYVALVQGYGY
SAAGEVMRSVLRGDLPSALAMLDAAHVLLQRDRETLDRVASAAVVLASAPPAGTAPERPV
SVGVLAHRLGVTPATLRKWERAGVLAPARSGTARAYSPEDVRDAELAHLLRRGGYLLDHI
AAVIEQVHTAGGAGPLADSIDQWRERITARGLAMLTGSARLAEYLSFLELTHGNAAASHD
RR
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
gtgtaccggccagtggatctggcgcggacgcacgggctgtccgcgcaggcggtccggaac
tacgagcaggccgggatgatccccccggccgcgcgcacggcgagcggctaccgggtctac
accgacaaccacgtgggtgcgctggccgcctacgtcgcgctcgttcaggggtacggctac
tctgcggccggagaggtcatgagatcggtactccgaggtgatctcccgtcggccttggcc
atgctcgatgctgcccatgtgctgctgcaacgcgaccgggagaccctggaccgggtcgcc
tcagcagccgtcgtactggcgtccgccccgccggccgggacagctccggaacggccagtc
tcggtcggagtcctcgcccaccggctcggtgtcaccccggccacgctacgcaagtgggaa
cgcgccggtgtcctggccccggcccggtcagggaccgcgcgcgcatactcacccgaggac
gtacgcgacgccgaactcgcccacctcctgcgtcggggcggctacctgctggatcacatc
gcggccgtgatcgagcaggtgcacaccgcgggtggggccggtccgttggcggactcgatc
gaccagtggcgggagcggatcacggcccgtggcctggcgatgctcaccggatctgcccgc
ctcgcggagtacctctcctttctcgagctgactcacgggaacgccgccgcctcacacgat
cgacgatga

DBGET integrated database retrieval system