KEGG   Salinispora arenicola: Sare_2421Help
Entry
Sare_2421         CDS       T00613                                 

Definition
(GenBank) transcriptional regulator, MerR family
Organism
saq  Salinispora arenicola
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2787257..2787985
Genome map
AA seq 242 aa AA seqDB search
MYRPVDLARTHGLSAQAVRNYEQAGMIPPAARTASGYRVYTDNHVGALAAYVALVQGYGY
SAAGEVMRSVLRGDLPSALAMLDAAHVLLQRDRETLDRVASAAVVLASAPPAGTAPERPV
SVGVLAHRLGVTPATLRKWERAGVLAPARSGTARAYSPEDVRDAELAHLLRRGGYLLDHI
AAVIEQVHTAGGAGPLADSIDQWRERITARGLAMLTGSARLAEYLSFLELTHGNAAASHD
RR
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
gtgtaccggccagtggatctggcgcggacgcacgggctgtccgcgcaggcggtccggaac
tacgagcaggccgggatgatccccccggccgcgcgcacggcgagcggctaccgggtctac
accgacaaccacgtgggtgcgctggccgcctacgtcgcgctcgttcaggggtacggctac
tctgcggccggagaggtcatgagatcggtactccgaggtgatctcccgtcggccttggcc
atgctcgatgctgcccatgtgctgctgcaacgcgaccgggagaccctggaccgggtcgcc
tcagcagccgtcgtactggcgtccgccccgccggccgggacagctccggaacggccagtc
tcggtcggagtcctcgcccaccggctcggtgtcaccccggccacgctacgcaagtgggaa
cgcgccggtgtcctggccccggcccggtcagggaccgcgcgcgcatactcacccgaggac
gtacgcgacgccgaactcgcccacctcctgcgtcggggcggctacctgctggatcacatc
gcggccgtgatcgagcaggtgcacaccgcgggtggggccggtccgttggcggactcgatc
gaccagtggcgggagcggatcacggcccgtggcctggcgatgctcaccggatctgcccgc
ctcgcggagtacctctcctttctcgagctgactcacgggaacgccgccgcctcacacgat
cgacgatga

DBGET integrated database retrieval system