KEGG   Salinispora arenicola: Sare_2425Help
Entry
Sare_2425         CDS       T00613                                 

Definition
(GenBank) Helix-turn-helix type 11 domain protein
Organism
saq  Salinispora arenicola
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2789598..2790335
Genome map
AA seq 245 aa AA seqDB search
MSSDQSRESRVLRLDRLKALLADRDYTTATDLAAELGVSTRTLHRDLALLREMGVPIEGD
RGTGGGLHLESGWSLGRVHLNESEALGLLLSLTIAEKVGSPLLLDDLRSITRKVAAAFAP
AQARRILALRRRILIGQTASVQVLASYTSPRAAVTKELLDSFTRCRTALVRYEDRHSAVT
EREIEIQFLYYNMPVWYALTWDRLRGDIRSFRIDRIQDIQALSTEFRLRPPAPFLAAGEE
TARAM
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcgatcagtcccgggagagccgggtcctgcgcctggacaggctcaaggcgctc
ttggcggatcgcgactacacaacggccaccgacctcgccgcagagctgggcgtcagcaca
cgcaccctgcaccgcgacctcgcactgctacgggagatgggagtccccatcgagggagac
cgggggacgggtggcgggctgcatcttgagtccggatggtcgctcggcagggtccacctc
aatgagtcggaggcgctcggcctgctcctcagcctcaccatcgccgagaaggtcggctcg
ccgctgctgctggacgatctacgctcgatcacccgtaaggtcgccgcggcgttcgcaccg
gcgcaggcacgtcgcatccttgcactgcgtcgtcggatcctgatcggccagaccgcatcc
gtgcaagtacttgcgagctacacctcgccgcgggcagcagtgacgaaggaactgctggac
tcattcacgcgatgccgcactgcgctggtgcgctacgaggaccggcacagcgcggtcacc
gagcgcgaaatcgagatccagttcctctactacaacatgcccgtctggtacgcgctgaca
tgggaccggctccggggcgacatccgttctttccgcatcgaccggatccaggacatccag
gcgctgtccaccgagttccgcctacgaccacccgctcccttcctggcggctggcgaggaa
accgcacgagccatgtga

DBGET integrated database retrieval system