KEGG   Salinispora arenicola: Sare_2428Help
Entry
Sare_2428         CDS       T00613                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulphide oxidoreductase
Organism
saq  Salinispora arenicola
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2791114..2792016)
Genome map
AA seq 300 aa AA seqDB search
MSEHDVVIVGGGAAGLSAALVLGRARRRVAIVDAGEPRNAPARHMQGFLSRDGMPPAELL
AAGRAEVTGYGVELVVGTVDRIEPGFAVQLGGGRMLAARRVLVATGLRDEIPDIPGLRQR
WARTVLHCPYCHGYEVRDRPLGVIASAEHALLVCQWSPDVVYFPHTSTVSDEDRARLTAR
GVRIVEGEVARIADGEAQMADGTTVDRQAFFVRPRFVPTSNLLSDLGAAVDAGGWAVVDS
TGRTSVPGVWAAGNAVDPRAQVITAAGQGSAAAIAINNDLVNDDIAQALTVLGPDPEPTF
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaacatgacgtggtgatcgtgggcggcggcgccgccgggctgagcgcggcactg
gtcctgggccgggcacgtcgcagggtggcgatcgtcgacgcaggcgagccgcgcaatgcc
ccggcgcggcacatgcagggtttcctgtcgcgtgacggcatgccgccggcggaactgctc
gcggcgggccgggcagaggtgaccgggtacggcgtcgagctcgtcgtcggcacggtcgac
cggatcgaacccggtttcgccgtccaactcggcggcggtcgaatgctggccgcccgaagg
gtcctggtggccaccggcctgcgcgacgagatccccgatattccgggccttcgccagcga
tgggcgcgaacagtgctgcactgcccgtactgtcacggctacgaagtccgcgaccggccc
ctcggtgtcatcgcctcggcggagcacgccctgctggtctgccagtggtcgcctgatgtc
gtctacttcccgcacaccagcaccgtcagcgacgaggaccgggccaggctgaccgcccgc
ggcgtgcgcatcgtcgaaggcgaggtcgcccgcatcgccgacggggaggcgcagatggcc
gacgggaccaccgtcgaccggcaggcgttcttcgtccgtccgcgcttcgtgccgacctcg
aacctgctgtccgacctcggcgccgccgtagacgccggcggctgggccgtcgtcgactca
accgggcgcaccagcgtgcctggcgtgtgggctgccggcaacgctgtcgacccgcgcgcg
caggtgatcaccgccgcggggcagggttccgccgccgcgatcgccatcaacaacgacctc
gtcaacgacgacatcgcacaagccctcacggtgctcgggcctgacccggaaccgactttc
tga

DBGET integrated database retrieval system