KEGG   Salinispora arenicola: Sare_2429Help
Entry
Sare_2429         CDS       T00613                                 

Definition
(GenBank) transcriptional regulator, XRE family
Organism
saq  Salinispora arenicola
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2792095..2792670
Genome map
AA seq 191 aa AA seqDB search
MNDTFSAALAEIGPRLKQARAQRGVTLAELAETTGISKSTLSRLEAGQRKPSLELLLPIA
AAHRIPLDKLVGVPQSGDPRVRLQPRKVNGRTVLPLTQHPGSLQAWKVIIPVDQSTPEPK
THEGYEWLYVLAGRLRLVLGDHDIVLGTGEAAEFDTRLPHWFGSTGHHPVEILSILGRQG
ERMHVRAKPKT
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgacactttcagcgcggccttggccgaaatcggcccccgcctgaaacaggcacgg
gcccaacgcggggtgacactggccgaactcgccgaaacgaccggaatctccaagagcacc
ctgtcccggctagaggccgggcagcgcaaaccgagcctggaactgctgctgcccatcgcc
gcagcccaccgcatccccctcgataaactcgtcggcgtaccccagagcggcgaccctcgc
gtgcgcctgcagccgcgcaaggtcaacggccgtaccgtcctgccgctgacccagcatccc
ggatccctgcaagcctggaaggtgatcatcccagtcgaccagtcgacgcccgagcccaag
acccacgagggctacgaatggctctacgtcctggccggaagactcaggctggttctcggc
gaccacgacatcgtcctcggcaccggcgaagccgccgagttcgacacccggctgccgcac
tggttcggcagcaccggacaccacccggtggagatcctcagcatcctcggccgccaaggc
gaacgcatgcacgtacgcgccaaaccgaagacctga

DBGET integrated database retrieval system