KEGG   Salinispora arenicola: Sare_2438Help
Entry
Sare_2438         CDS       T00613                                 

Definition
(GenBank) hypothetical protein
Organism
saq  Salinispora arenicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2798667..2799101
Genome map
AA seq 144 aa AA seqDB search
MDWAPHSYRLVPRLHERWEARGKALPGFHTPHNPTHLLVYPEAVALTEVFCDLEWRRHIA
MVREFQTANFYQHVAKRLNQPPDFARWLERPWTRLLRRNYESVPNPIQRWINEIRHKHAK
TRTEFYERHAGFTRTPFPEIRHFK
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atggactgggcgccccacagctatcgcctcgttccccgtctacatgaacgctgggaagcc
cgaggcaaggcactccccggcttccacaccccgcacaacccgacccacctgctcgtttat
cccgaagctgtcgctctgaccgaggtcttctgcgacctcgaatggcgccgccacatcgcg
atggtccgcgagttccagacggccaacttctatcaacacgtcgcgaaacgcctcaaccag
ccacccgacttcgcccgctggctggaacggccttggacccgcctcctgcgccgcaactac
gagtcggtccccaacccgatccagcggtggatcaacgagatccgccacaagcacgcgaag
acccgcaccgagttctacgaacgccacgcggggttcacccgaaccccgttccccgaaatc
cgccacttcaagtga

DBGET integrated database retrieval system