KEGG   Salinispora arenicola: Sare_2441Help
Entry
Sare_2441         CDS       T00613                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01822  
steroid Delta-isomerase [EC:5.3.3.1]
Organism
saq  Salinispora arenicola
Pathway
Steroid degradation
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:saq00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Sare_2441
Enzymes [BR:saq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.1  steroid Delta-isomerase
     Sare_2441
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2800483..2800884
Genome map
AA seq 133 aa AA seqDB search
MTDKTSPATSVSDRAMSAVMAKDRGAWLDCFAEDALLRDPVGGSPLDPHGRGFRGHAALA
QFWDSLVEPAQDVRFVVREEYPSPEATAKVASVAITLPGGEALTYDGVFVYEVDESGRIA
SLSGYFTPPFPAM
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
gtgacggataagacctcgccggccacgtccgtgtccgaccgcgccatgagtgctgtcatg
gcgaaggaccggggcgcgtggctcgactgcttcgccgaggacgcgctgctgcgcgacccg
gtgggtggttcgccgcttgatccgcacggaaggggctttcgggggcatgccgccttggcg
cagttctgggactcattggttgagcccgcccaggacgtgcgcttcgtcgtacgcgaggag
tacccctcgcccgaggccacggcgaaggtggcgtcggtcgccatcacgctgcctggaggc
gaggcgctcacctatgacggtgtgttcgtgtacgaggtggacgagtccgggcggatcgcg
tccttgagcgggtacttcacgccccccttccccgcgatgtag

DBGET integrated database retrieval system