KEGG   Salinispora arenicola: Sare_2445Help
Entry
Sare_2445         CDS       T00613                                 

Definition
(GenBank) hypothetical protein
Organism
saq  Salinispora arenicola
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2803204..2803422
Genome map
AA seq 72 aa AA seqDB search
MPPVASPDIDISSAEEIINRWLSDTSLDGSDSPAGPLFTGGRYVVQEITATFGGTGTARC
SSCTGSHRIGCC
NT seq 219 nt NT seq  +upstreamnt  +downstreamnt
atgccacctgtggcatcgccagacatcgacatctcgtcggcggaggagatcatcaaccgc
tggttgtccgacacgtcgctggacgggtcggacagcccagccggtccgctgttcaccggc
gggaggtacgtggttcaggagatcaccgcgacctttggcggaaccggaactgcaaggtgc
agctcctgcacgggttcacaccggatcgggtgctgttga

DBGET integrated database retrieval system