KEGG   Salinispora arenicola: Sare_2449Help
Entry
Sare_2449         CDS       T00613                                 

Definition
(GenBank) protein serine/threonine phosphatase
Organism
saq  Salinispora arenicola
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2809731..2810450)
Genome map
AA seq 239 aa AA seqDB search
MTVRIDVAGGRHVGLGRQRNEDAIHVGRWLFAVADGLGNHGAGDVASATAIEAVRRYDRV
VDPDALPVVLGQAVHAANDALGRRVEAEPGLAGMGTTLVALLRTGTAAALANIGDSRAYH
LRGLGSPHSATTQITEDHLYRHLVADAADMPNLSDKMSRYLDGCPGGQSADITLLTLTPG
DRILLCSDGLSSYLSHKRLHTTLATSATPRRAVDQLIASALAQGGPDASAVIIFVRNGR
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtgcgcatcgacgttgcggggggccgtcacgtggggctcggtcgacagcgcaac
gaggacgccattcacgtggggcgctggctgttcgcggtcgccgatggtctcggcaaccac
ggcgccggcgacgtcgccagcgccacagcgatcgaggcagtgcggcggtacgaccgggta
gtggacccggatgcgctgccggtggtgctggggcaggcggtacacgccgcgaacgacgcg
ttggggcgccgcgtggaagccgaaccgggattggcgggcatgggtacgacgttggtcgcc
ctgctcagaaccggcacggcagccgccctggccaacatcggtgactctcgggcttatcac
ctacgtgggttgggctcgccgcacagtgcgaccacccagatcaccgaggaccacctttac
cggcatctggtcgctgatgccgccgatatgcctaacctttctgacaaaatgtcgcgttac
ctggatggctgccccggcggccaatcagccgacatcaccctgttgaccctgacccccggc
gaccggatcctgttgtgttccgacgggctcagctcctacctgtcacataagcgcctccat
accaccctggctacctcggcgactccgcggagggcggtggaccagttgatagcgtccgcg
ctggcgcagggtgggcccgacgcatcggcggtcatcatcttcgtccgtaacggaaggtga

DBGET integrated database retrieval system