KEGG   Salinispora arenicola: Sare_2451Help
Entry
Sare_2451         CDS       T00613                                 

Definition
(GenBank) conserved hypothetical protein
Organism
saq  Salinispora arenicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SfLAP CECR6_TMEM121
Motif
Other DBs
NCBI-ProteinID: ABV98298
JGI: Sare2451
UniProt: A8M336
Position
complement(2811205..2811927)
Genome map
AA seq 240 aa AA seqDB search
MDAALIGSLVVLAVIDSTSFGTFLIPIWMMLAPGRLQSARLLVYLATVAVFYLVIGVVLL
FGAAVFLDDLRPALESRPFQVAQLVFGIGLLGFALVTGRRRPTGDTEPGRLVRWRERAMT
GQASSKALIGLALAAVTLEAATMLPYLAAIGLLGAAALTLPARIAILAGYCVVMILPALV
LLAARLGVAERVQPMLVAVNRWMARNAANTTAWVVGILGFLFASDAARQLELFEALSKAI
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
gtggacgcggccctgatcggatcgctcgtcgttctggccgtgatcgacagcaccagcttc
ggcacattcctcatcccgatctggatgatgctggcaccgggccggctgcagtcggcccgg
ttgctggtctacctcgccacggtcgcggtcttctaccttgtgatcggcgtggtgttgctg
ttcggggcggcggtgttcctcgacgacctacgtcccgcactggaaagccggcccttccag
gtggcgcaactcgtgttcgggatcggcctgctgggcttcgcgctggtcaccggcagaagg
cggccgacgggcgacaccgagccgggccggctggtgcgttggcgtgaacgggccatgacg
gggcaggcatcctcgaaggcgctgatcgggctggcccttgccgccgtgacactggaggcc
gccaccatgctcccctacctggcggccattgggctgctcggcgcggctgcgctcacactt
cccgcacgtattgcgatactcgccggatactgcgtcgtcatgatcctgcccgcactcgtg
ctgctggcggcccgactgggcgtggccgaacgggtacagccgatgctcgtggccgtcaat
cggtggatggcccgcaacgcggccaacaccaccgcatgggtcgttggcatcctgggcttc
ctgttcgccagcgatgcggcccggcagctggagttgttcgaggcactgtcgaaggcgatc
tga

DBGET integrated database retrieval system