KEGG   Salinispora arenicola: Sare_2452Help
Entry
Sare_2452         CDS       T00613                                 

Definition
(GenBank) aminotransferase class I and II
Organism
saq  Salinispora arenicola
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2812244..2813404)
Genome map
AA seq 386 aa AA seqDB search
MTVSRLRDIPGIGVDVVGDAADAVADPDFLRLENLDTDVRPPTVAVTSTRAAIDDDAANS
YLPFQGHRSLRSAATAHVGRIAGRRFDPGTECVSVAGGLNGIFNALLATVEPGQEVVLVD
PIYAGLVNRVRLAGGVPRFVPARATPDGWSVDPQRLASAVGPDTAAVLMMGPAMPSGLVL
DTQHWSALSDACERHNAWLIYDAAMERIRFDGRRPSHPAAHDGLAGRTITVGSASKELRL
IGWRVGWVVGPADILADIKLVGLTNVVCQVGLAQGAVAAALDAPDADADVAAATREWQRR
CDTILNQLSDYPIIRPHGGWSLLVDTRPLGLTPTALARLLFDRAKVAATAMDGWGPSGEH
YLRIVFANEPVERLTSLADRFRQAIG
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcagtcgtctacgcgacatcccaggtatcggcgttgacgtggtcggcgacgcc
gcggacgcggtagccgacccggactttctccgtctggagaatctggacaccgacgtgcgg
ccgcccaccgtggcggtcacctcgacccgagccgccatcgatgacgatgcggccaacagc
tacctgcccttccaggggcaccgttcccttcgttcggctgccacggctcatgtgggacgc
atcgctggacgcagatttgatcccggcaccgagtgcgtcagcgtcgccggcgggctgaac
ggcatcttcaacgcgctacttgccacggtggaaccgggccaggaggtggtgctggtcgac
cccatctacgccggcctggtcaaccgggtccggcttgccggtggggtgcctcgcttcgtg
ccagcccgcgccacgccggatggctggtcggtggatccgcaacgcctggccagcgctgtt
ggacccgataccgctgccgtgctgatgatgggcccggccatgccgtccggtctggtgttg
gacacgcagcactggtcggcgttgtccgatgcctgcgagagacacaacgcctggctgatc
tatgacgcggcgatggagagaatccggttcgacggtcgccgccccagccatccggcggcc
catgacggcctcgccggacgtaccatcacggtgggttcggcatccaaggaactgcggctg
atcggctggcgggtcggttgggtcgtggggccggcggacatcctcgccgacatcaagctg
gttggcctgacaaacgtggtctgccaggtcgggctggcgcaaggtgcggtggctgccgcg
ctcgacgcacccgatgccgacgccgatgttgccgccgccacccgtgagtggcagcggcgc
tgcgacacgatcctcaaccagctttcggactatccgatcattcggccacacggcggctgg
tcgctcctcgtggacacccggcccctgggcctgacgcccaccgcgcttgcccggctactg
ttcgaccgggccaaggtcgcggccacggcgatggatggctggggccccagcggcgagcac
tacctgcggatcgtgttcgccaacgaaccggtcgagcggctcaccagcctggcggaccgc
ttccgccaggccatcgggtga

DBGET integrated database retrieval system