KEGG   Salinispora arenicola: Sare_2458Help
Entry
Sare_2458         CDS       T00613                                 

Definition
(GenBank) hypothetical protein
Organism
saq  Salinispora arenicola
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2816588..2818567
Genome map
AA seq 659 aa AA seqDB search
MLPESWYKALVRSSGEPWVARRSSLRPAFPAVHNVWVVYRMTPSSGADVLAGALQWRDAT
LERWTPLGELEVVTASVEVAAWCADTRPFVGQHGKAWQSVIADFRQAVASAGSLLASRLR
DNVRDVMGRLGDLSQGVAAKQPNHQVDALIAAARPSAQALMEQLRHPETVVAAWTDLSRA
CLSPAPEWALVARARDTFVHLASLSGHGSRWLSMQLSWAVVGEPHAVEWLIREVGAPGPG
HSRWVPLADRISLGARYFKRPVVQRRQVVWFALRRAMIRQFTISFGAINFYYAPILHAVA
SSAQRTSLLPAELQGDSPFGLVQMPNDQDVVFARVDLAAAKPRDPVREARDVLIGALGMV
RFGGLDSGNWQLMNGHVHAVNGHVVHHAVFWPRDEQPRLDYKADSTVDMLTHRAAAAGIT
DPSDHRARELRAAIRWCDEAEDLGAAAATLLYVRVIELFASRIAKKQWYDFLDEYVSPAW
VRGRMQRTVYDVVHGALHPDGISERSDDVAALRRETYTIRGSFSESTHSALLTALDSLDG
MPGIVGALAVQIRGLRERVDDTATVHLWRNEVRAEWSALSSRLRRVRNSLAHGGPYTDEV
IDSLVDYARDLARTVLNWGIDAMAAGTDVAVVAAERRDTAATWELAIPAAANAPIALFG
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgcttcccgagtcgtggtacaaggctctggtgcgctcatcaggtgagccatgggtagcg
cggcggtccagtctcaggcctgccttcccagccgtccataatgtttgggtggtctaccgg
atgacgccgtcgtcgggcgctgatgttcttgccggtgccctgcagtggcgagatgcgacg
ctggagcggtggacgcccttaggcgagctggaagtcgtcaccgcgtcggttgaggtggcc
gcttggtgcgcggacactaggccgttcgtcggacagcacggaaaagcttggcaaagcgtc
atcgcggactttcgccaggcagtagccagcgccggttcgctgctcgcatcgcggttgcga
gacaacgttcgcgacgtcatgggacggctgggggatctatcgcaaggggtagcggcaaag
cagccgaaccatcaggtggacgccctcatcgcggcggcgcggccgtccgcccaggccctc
atggagcagctccgccatccagagaccgtcgtggccgcttggacggaccttagccgagcc
tgcctctcgccggcgccagaatgggcgttggtcgcccgggcacgggatacattcgtacat
ctggcttcgctgtcgggacatggttcccgctggctgtcgatgcagctttcgtgggcagtc
gtgggagagccgcacgctgtcgaatggctcataagggaagttggtgcgcccggcccgggc
cactctcggtgggtcccactcgcggaccgcatcagtttgggtgcgcggtacttcaaacgt
ccggtcgtgcagcggcggcaggtggtttggttcgcccttcgacgagccatgatccgccag
ttcacgatttcgttcggggccattaatttttactacgcaccgattttgcacgcagtggct
tcgagtgcgcagcgcacttcgctcttgcctgccgagttgcaaggcgattcgccgttcggg
ctggttcagatgccgaacgatcaggatgtcgtcttcgcccgagtggacctagccgcagcg
aagcctcgcgatcccgtccgcgaagcgagggatgtcctgatcggtgctctaggcatggtc
cggttcggcggtctggacagcggcaactggcagctgatgaacggacatgttcatgccgta
aacggccacgtcgtgcaccatgccgttttttggccgagggacgagcagccacgcttggac
tataaggccgactccaccgtcgatatgctcacccaccgcgcggcggcggcaggtatcacc
gaccccagtgatcaccgtgcccgagagttgcgggcggcgatcaggtggtgtgatgaggcc
gaagacctgggcgcggcagcagcgacgctgctctacgtccgtgtcatcgagctcttcgcc
tcgcgtatagcgaagaagcagtggtacgacttcctcgatgagtacgtaagtcctgcctgg
gtgcggggccgcatgcagcgcaccgtctatgacgtcgtgcacggcgcgctccacccggat
ggaatttccgagcggagcgatgacgtggcggcgctgcgacgcgagacctatacgatccgc
ggctccttcagcgaaagcacccacagcgcgctgctcactgccctcgacagcttggatggc
atgccggggatcgttggggcactggccgtacaaattcggggccttcgagaacgagtcgac
gacacggcgacggtccacctgtggcgcaatgaggtacgggccgagtggtccgcgttgagc
tcacgcctgcgacgggtacggaactcgctcgcccacggcgggccttacacggacgaagtc
atcgattccctagtcgactacgcccgagacctcgctcggacggtcctgaactggggaatc
gatgccatggctgcgggcaccgacgtcgccgtggttgccgccgaacggcgcgataccgca
gccacgtgggagttagcgatcccggcggcggcgaatgcccccattgcgctctttggttag

DBGET integrated database retrieval system