KEGG   Salinispora arenicola: Sare_2459Help
Entry
Sare_2459         CDS       T00613                                 

Definition
(GenBank) restriction endonuclease
Organism
saq  Salinispora arenicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2818949..2819752
Genome map
AA seq 267 aa AA seqDB search
MDWKQYQREVAAFLSSLGFDTKVDETVHGARAVHDIDVTARSRIAGVNQLWVVECKLWKR
PVPKERVLTFRGVVDDVGADRGVLFSESGFQSGAKTAAHKTNISLTSFADFERDFSNEVA
AARARTLDLRLANLMQAFNRLWDLPQADRESAFSKYCGPSGLLGLEHTSHAVVGVTARIS
QMRQALEDAQFGRWPVAFYPLDHDGFELIEVRMWDGLFFVVEQTLEACERIYAHMTDPKS
GDADWRDFQSTELTELLRKIRSTRTST
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggactggaagcagtatcaaagggaagtcgccgcattcctttcaagcctgggcttcgac
acgaaggttgatgagactgttcatggtgctcgcgcggtacacgatatcgacgtcacggca
cgctccagaattgcgggcgttaatcagctctgggtagttgaatgtaagctatggaagcga
ccggtcccgaaggagcgggtccttacatttcggggagttgtcgacgatgttggcgccgat
cggggagttcttttctcggagagcgggtttcaatcaggcgcaaaaactgctgcgcataag
accaatatttcgctaacaagttttgcggatttcgaacgcgatttctcaaatgaggtcgcg
gcagcaagagcgagaaccctggatttgagactggcgaatcttatgcaggccttcaaccgg
ctgtgggacttgccgcaggctgatcgtgaatctgccttcagtaaatactgcggcccatct
ggacttctgggcttggagcatacgtctcatgcagtcgtgggcgttactgcccggatctcg
cagatgaggcaggcgctggaagacgcccaattcggtcgttggccggttgctttctaccct
ctggaccacgacggctttgagctaattgaagtccgcatgtgggacgggttgttcttcgtc
gtcgaacagacattagaagcttgtgagcgcatatacgctcacatgactgatccgaagtca
ggtgacgcagattggcgcgacttccagtcgacggaactcacagagttactgcgaaagatc
cgttctaccagaacctcgacttga

DBGET integrated database retrieval system