KEGG   Salinispora arenicola: Sare_2468Help
Entry
Sare_2468         CDS       T00613                                 

Definition
hypothetical protein
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
saq  Salinispora arenicola
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Methane metabolism [PATH:saq00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2826700..2827431
Genome map
AA seq 243 aa AA seqDB search
MMTAVPTSAFSAFALEPFPELQPGADLAGAITGVLACTGIELQDGDVVVVASKAVSVAEN
RYVDLAGVVPGPEALELSARTGKPAEVVQLILDSSDSYFLAAEEGPIIARHRLGFQLTSA
GIDRAGPQGAWLLPVDPDASARALRDALIAYSGADVAVVVADSDGRADRRGATVISIGAA
GVGPLRVTEFGGKRQEETFTDLIAAAAGIILGQRGRGAPVAVLRGIAYESSDAGVASMLQ
HRP
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccgccgtcccgacctccgctttctccgctttcgccctggagccctttcccgag
ctccagccgggtgcggacctggcgggcgccatcaccggcgtcctggcctgtactggcatc
gagttacaggacggggatgtggtggtggtggcttccaaagccgtgagtgtcgcggagaat
cggtacgtggatctggccggtgtcgtcccgggtccggaggcgctggagttgtccgcacgc
acgggcaagcccgccgaggtcgtgcagctgatcttggattccagtgacagttactttctg
gctgccgaggagggcccgatcatcgcgcggcacaggctcggcttccagctcacctccgcc
gggatcgaccgggccggcccgcagggtgcgtggctgttgccggtggatccggacgcctcc
gcccgcgccctgcgcgacgcgttgatcgcctactccggcgcggatgtggcggtggtggtc
gcggattctgacggtcgtgccgatcggcgtggggcgactgtcatttcgatcggcgcggcg
ggcgtggggcctttgcgtgtgacggagttcggcggtaaacggcaggaagagactttcact
gacctgatcgccgcggcggccgggatcatcctcgggcagcggggccgtggggccccggtc
gccgtcctgcgcggcatcgcctatgagagcagtgatgcgggcgtggcgtcgatgctccaa
caccggccgtga

DBGET integrated database retrieval system