KEGG   Salinispora arenicola: Sare_2604Help
Entry
Sare_2604         CDS       T00613                                 

Definition
NAD-dependent epimerase/dehydratase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
saq  Salinispora arenicola
Brite
Enzymes [BR:saq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     Sare_2604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2969572..2970546
Genome map
AA seq 324 aa AA seqDB search
MEQVLVTGATGTVGSLLVRDLAGRGVRVRALVRSPERAAAALPPGVEAFRGDVTDLASVR
SAVRGCDTVFHTAGLPEQWLADPDVFEQVNVNGTRHLVEAALTEGVATFVHTSTIDVFDR
VPGVPFDESRSLAVRPLGSAYERSKQRADRLVAKAVERGLPARIVHPSAVYGPGPATATA
LNLVLLRLARNQIPALPPGGMPVVFTEDVSQGHLLAAEAPIGTRWILSDRYLTMTAIAES
VRTVVPTSKVPRTMPTALATTLATAGEVVARVIRRPPLLAAGELYFLRSHSLPDSSRARG
QLGWHTTEVQEGFARALRHFGVLR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggagcaggtacttgtcacgggagccactggcaccgtaggtagccttctggttcgggac
cttgctggccgcggcgtccgagtgcgcgcgctggttcgttcgccggaacgggcagcggcg
gccctgcccccgggcgtggaggcgtttcggggagatgtcaccgacctggcgtcggtacgg
tccgcagtcaggggatgtgacaccgtctttcacactgccgggctacccgagcagtggttg
gccgatcccgacgtcttcgagcaggtcaacgtcaacggcacccgtcacctggtggaggca
gctctcacggagggcgtggcgacgttcgtccacaccagcaccatcgacgtcttcgaccgt
gttcccggcgtgccgttcgacgagtccaggagtctcgcagtgcgtccgctcggatcggca
tacgagcgttccaagcagcgcgccgaccgtcttgttgccaaggctgtcgagcggggcctg
ccggcacggatcgtgcatccgtctgcggtctacggaccaggtccggcaaccgcgaccgcg
ctgaacctggtgctgctcaggctggcccgtaatcagattcccgcgctgcccccgggtggc
atgcccgtcgtcttcacggaagacgtctcacagggacatcttctcgcggccgaggcgccg
atcggcactcggtggatcctctcggaccgctacctgaccatgaccgccatcgccgagtcg
gtccgcacggtggtgccgacgtccaaggtcccccgcaccatgccaacggccctcgcgaca
accctggccactgccggtgaggtcgtcgcccgcgtgatccgcagaccgcccctgctcgcc
gcgggcgagctgtactttctacgctctcactcgctaccagactcctcccgggcgcgcggc
caactgggctggcacaccactgaggtgcaggagggctttgcccgcgccctgcggcacttc
ggcgtactgcgctag

DBGET integrated database retrieval system