KEGG   Salinispora arenicola: Sare_2630Help
Entry
Sare_2630         CDS       T00613                                 

Definition
ABC transporter-like protein
Orthology
K11084  
2-aminoethylphosphonate transport system ATP-binding protein
Organism
saq  Salinispora arenicola
Pathway
ABC transporters
Module
2-Aminoethylphosphonate transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:saq02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2995794..2996930)
Genome map
AA seq 378 aa AA seqDB search
MSESPAVQFDRVSVRYGQVTALRDFSLDVAVGETVALLGPSGSGKSTALKALAGFVRPTS
GRVLLNGHDVTGAPPHKRGLGVVVQQYALFPHLTVADNIAFGLRARRVRRAESARRVEEM
LDLVGMDRYGRRYPRELSGGQQQRVAIARALAIRPPVLLLDEPLSALDAQLRADMLDELR
QLRDELPDVAMLYVTHDQTEALTLAHRIAVMREAELLDLDTAQGLYRQPPSEFTAAFLGG
ANLLPATVRDVNGTVQVGAVTITATAPGPLTPGARVRLAVRPHTIGVRTDGPGLAAVLTG
LQWRGANYRLTCLIDGLDEPGGLSVHVDVPSIDGLPQVGSPVRVGLPEHGAAVVARTGAG
VPTGGAANAVAQDLAGVA
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagtcgccggcggtccagttcgaccgcgtcagcgtccgctacgggcaggtcacg
gcgctgcgggacttctcgctcgacgtagccgtcggcgagacggtggccctgctcggcccc
tccgggtcgggcaagtcaaccgccctcaaagcgctggccggattcgtccggccgacatcc
ggccgggtcctgctcaacggacatgacgtcaccggggcaccaccgcacaagcgtgggctc
ggcgtggtggtgcagcagtacgccctcttcccgcacctcaccgtcgccgacaacatcgcg
ttcggcctgcgtgcccggcgggtgcgacgcgccgagtcagcccgacgtgtcgaggagatg
cttgatctggtcggcatggatcgttacggccgccgctacccgcgggagctctccggcggg
cagcaacagcgggtggcgatcgcccgcgcgttggcgatccggccgccggtgctgctgctc
gacgagccactgtccgccctcgacgcgcagctgcgcgccgacatgctcgacgagctgcgt
cagcttcgagacgagcttccggacgtcgcgatgctctacgtcacccacgaccagaccgag
gcgctcaccctggcgcaccggatcgctgtcatgcgcgaggccgaactgctcgacctggac
accgcccagggcctctaccggcagccaccgagcgagttcaccgccgccttcctgggtggg
gcgaacctgctgccagccaccgttcgtgatgtcaacggcacggtccaggtgggtgcggtc
accatcaccgccaccgcccccgggccgctcactcccggcgcccgcgtccggctcgcggtc
aggccacacaccatcggggtacgcactgacggacccggcctcgcggccgtcctcaccggc
ctgcagtggcggggtgccaactaccggctgacctgcctgatcgacgggctcgacgagccc
ggcgggctcagcgtgcacgtcgacgtgcccagcatcgacgggctcccgcaggtcggctcc
ccggtacgggtcgggttgccggagcatggcgccgcggtggtggccaggacgggcgcgggt
gtccccaccgggggcgccgccaacgccgttgcccaggacctggcaggtgtggcatga

DBGET integrated database retrieval system