KEGG   Salinispora arenicola: Sare_2810Help
Entry
Sare_2810         CDS       T00613                                 

Definition
cholesterol oxidase (EC:1.1.3.6)
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
saq  Salinispora arenicola
Pathway
Steroid degradation
Brite
KEGG Orthology (KO) [BR:saq00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Sare_2810
Enzymes [BR:saq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Sare_2810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3191532..3193163
Genome map
AA seq 543 aa AA seqDB search
MTGTSFSRRGLLRATTLGAGAAVAGAALAQRAAAAQGVVPALAGKTAVVVGSGFGGAVAA
YRLGQAGVITTVLERGLRWDVDGSGNTFCGINEPDWRCGWFLDRPPLGINLGARIERRAG
LIARHEGDGINVLSGVGVGGGSLAIGMFLPQPRRSEWEQVYPADVGYDEMNTIYWPRARQ
RLGASPIPEDVQSTGPYRGARAWLEYLSEFDQNPLSIPFAVDWDVIRAELAGDAVACHTI
GEGPYGSNSGAKNSVDRNYLAWAAATGNVTTLPLHEVTEIHEVSGQDRFEVRCRQIDVYG
TVLATRTFACDYLFLAAGSVYTTSLLLTSQAKGWLPRLVNPEVGKGWGNNGDFLVTRINL
RKDVGYAQGGPGNVKYIDDDNPFAPTSMAWEAAPVPNWMPRTTAHLVTSMAPERGEIRYD
ATTGAAKVHWPYGVLQTTAEKAAVNLVTRLWWQTEGRKGYLLNGLPTYARGVGTGLGAAN
TWHPLGGMVMGGATDFGGRCVDYPNLFCVDGSILPGSACLANPALTITANAERCLDRFVA
AHT
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgactggtacgagcttttcccgacgtggcctgctacgggctaccacgctcggtgccggc
gccgccgttgccggtgccgcgttagcccagcgggcagccgcggcacagggtgtcgtgccc
gcgctggccggcaagaccgccgtggtcgtcggcagcggcttcggcggggcggtcgccgcg
taccgactcggccaggccggtgtgatcaccaccgtgctggaacgcggtctccgctgggac
gtcgacggctcgggcaacacgttctgtggcatcaacgagccggactggcggtgcggctgg
ttcctggaccgtccgccgctgggcatcaacctcggcgcaaggatcgaacgtcgtgccggc
ctgatcgcccgccacgaaggcgacggaatcaatgtcctcagcggtgtgggggtcggcggc
ggctccctcgcgatcgggatgttcctaccgcagccgcggcgcagcgagtgggagcaggtg
tacccggccgacgtcggctacgacgagatgaacaccatctactggccgcgagcccggcaa
cgcctcggggcctcgccgataccagaggacgtgcagagcacaggtccgtaccggggggcc
cgagcctggctggagtacctgtcggagttcgaccagaatcccctgtccatcccgttcgcc
gtcgactgggacgtgatccgtgccgaactcgcgggtgacgcggtggcatgccacacgatc
ggcgagggcccgtacggcagcaactccggggcgaagaacagcgtggaccgcaactacctg
gcctgggccgccgctaccggcaacgtgacgacacttcccctccacgaggtcaccgagatt
catgaggtgtccggccaggacaggttcgaggtcaggtgccgacagatcgacgtgtacggc
acggtcctcgccaccaggaccttcgcctgcgactacctgttcctggccgccggctccgtc
tacaccacctccctgctgctcacctcccaggccaagggctggctcccccgcctggtcaac
ccggaggtgggcaagggctggggcaacaacggcgacttcctggtaacccggatcaacctg
cgcaaggacgtcggctacgcccagggcggtccgggcaacgtgaagtacatcgacgacgac
aacccgttcgcccccacgtcgatggcgtgggaggcagcgcccgtccccaactggatgcca
cgcaccaccgcgcacctggtgaccagcatggcacccgaacgtggcgagatccgctacgac
gcgacgaccggagccgccaaggtgcactggccgtacggggtgctgcagaccaccgctgaa
aaggcggcggtcaacctggtgacccggctgtggtggcagaccgagggccgtaagggatac
ctgctcaacggcctaccgacctacgcccggggggtcggcaccgggctcggcgcggcgaac
acctggcacccgctgggcggcatggtcatgggcggggccaccgacttcgggggtcgctgc
gtcgactatcccaacctcttctgcgtcgacgggtcgatcctgccgggatcggcctgcctc
gcgaatcctgcgctgaccatcaccgccaacgccgagcgttgcctggacaggttcgtcgcc
gcgcacacctga

DBGET integrated database retrieval system