KEGG   Salinispora arenicola: Sare_3061Help
Entry
Sare_3061         CDS       T00613                                 

Definition
(GenBank) Pyridoxal-5'-phosphate-dependent protein beta subunit
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
saq  Salinispora arenicola
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:saq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sare_3061
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sare_3061
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sare_3061
Enzymes [BR:saq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sare_3061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3469140..3470483)
Genome map
AA seq 447 aa AA seqDB search
MTVSIPTKWRSVLPHLDAPLPPDRTPARVTADNAVSVNLPMALVRQCTRNDEYWEIPLPV
LDAYRSYRPTPLWRATRFETAVGAKVPIWVKYEGGNISGSHKLTTALAQAYYYRNAGARE
LVTGTGAGQWGTALAAACALFGLRCTVFMVGSSLSRKPYRGVLMKMLGAEVQASPSGTTR
VSRSAQGQGNSLSLAIGEAVEYAAGRDGAAFCIGSGETYSILHQSVIGIEAGEQLQEQGG
EVDAVVGCVGAGSNFGGVALPFHAEARSQGTNAPLLVAAESSSAPKLTQGIYAYDRTDST
DTSPLEAMYTIGSSYSIPDSHSAGLRFHGAAKLVSALRHSGHVAAMAIDQVVALEAGQRF
ATTEMVVPAPESGHALAAAAQLATTGADDLQASHGVLVCVSGHGYLDLSAYQQLLDGELN
DQSPDAQALLAAVSGLAPVSTTAAVAQ
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
gtgactgtgtcaatccctacaaaatggcgcagcgtactgccgcacctggacgcccccctg
cctccggaccggacgccggcgcgtgtcacggcagacaacgccgtctcggtgaacctgccc
atggccctggtccggcagtgcacccgcaacgacgagtactgggagatccccctaccagtg
ctggacgcctaccgcagctaccggcccaccccgctgtggcgggccacgcggttcgagacc
gccgtgggggcgaaggtgccgatctgggtaaaatacgaagggggcaacatctctggcagc
cacaagctcaccaccgcgcttgcccaggcctactactaccgcaacgccggcgcgcgggaa
ctggtgactggcaccggggcaggccaatggggcactgcgctggctgcggcctgcgcactg
ttcggattgcgatgcaccgtgttcatggtgggaagcagcctgtcccgcaagccctaccgc
ggcgtgttgatgaagatgctgggtgccgaggtgcaggccagccccagtggcaccacccgg
gtgtcccgctctgcacagggtcagggcaacagcctctccctggccatcggcgaggcggtc
gagtacgccgctggcagagatggtgcagcgttctgcatcggcagcggtgagacgtacagc
atcctgcaccagtccgtgatcggcatcgaggccggcgagcaactccaagagcagggcggc
gaagtcgacgccgtggtgggctgtgtcggcgccggctccaacttcggcggagtggctttg
cccttccacgctgaagcccgcagccagggcacgaacgcgccgctgctggttgcagcggaa
tccagcagcgccccgaagctcacccagggaatctacgcctacgaccgcaccgactcgacc
gacacctcaccgctggaggccatgtacaccatcggcagctcgtactccatccccgactct
cactcggccgggttgcgcttccatggcgcagcgaaactcgtctccgccctgcggcactcc
gggcacgttgcggccatggcgatcgaccaggtcgtggccctggaggccggacagcggttc
gccaccaccgagatggtggtgcccgctcccgagtccggtcacgccctcgccgccgcggcg
cagctggccaccaccggtgctgatgacctacaggcgtcgcacggggtactggtgtgcgtc
agcggccatggctacctcgacctcagcgcctaccagcagctgctcgacggggagctgaac
gaccagtccccggacgcgcaagctctgctcgccgccgtgtctggtctcgccccggtgtcg
accacggcggcggtggcccaatga

DBGET integrated database retrieval system