KEGG   Salinispora arenicola: Sare_3323Help
Entry
Sare_3323         CDS       T00613                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
saq  Salinispora arenicola
Pathway
saq00010  Glycolysis / Gluconeogenesis
saq00051  Fructose and mannose metabolism
saq00562  Inositol phosphate metabolism
saq01100  Metabolic pathways
saq01110  Biosynthesis of secondary metabolites
saq01120  Microbial metabolism in diverse environments
saq01130  Biosynthesis of antibiotics
saq01200  Carbon metabolism
saq01230  Biosynthesis of amino acids
Module
saq_M00002  Glycolysis, core module involving three-carbon compounds
saq_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:saq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sare_3323
   00051 Fructose and mannose metabolism
    Sare_3323
   00562 Inositol phosphate metabolism
    Sare_3323
Enzymes [BR:saq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Sare_3323
Exosome [BR:saq04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Sare_3323
  Exosomal proteins of bladder cancer cells
   Sare_3323
  Exosomal proteins of melanoma cells
   Sare_3323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABV99126
JGI: Sare3323
UniProt: A8LW17
Position
complement(3835258..3836049)
Genome map
AA seq 263 aa AA seqDB search
MANPTRRPLMAGNWKMNLNHLEANLLVQKLAASLTAKQLTDVEAVVLPPFTDLRTVQTAV
DGDKLLVGYGAQDLSPHASGAHTGDIAGPMLAKLGCTYVVVGHSERRADHHEDDAVVNVK
VQAALTHGLTPILCVGEGLDIREQGSQVAYCNDQLDAALKGLSAEQVAQVVVAYEPVWAI
GTGKTATPEDAQEVCGALRQRLAGHFGQDTADQVRILYGGSVKSSNVAAIMAQTDVDGAL
VGGASLDAEEFAKICRFPEHTAG
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggccaaccccacccgccggccgctgatggccggcaactggaagatgaacctcaaccac
ctcgaggcgaacctgctggtgcagaaactcgccgcgagtctgaccgccaagcagctcacc
gatgtcgaagcggtggtgctaccgccgttcaccgacctgcggacggtgcagaccgccgtc
gacggggacaagctgctggtcggctacggcgcgcaggacctttccccacacgcgtcgggg
gcgcacaccggcgacatcgccgggccgatgctggcgaagctgggctgcacgtacgtggtg
gtcggccactccgagcggcgggcggaccaccacgaggatgacgcggtcgtcaacgtgaag
gtgcaggcggccctcacccacggtctcaccccgatcctctgcgtgggggaggggctggac
atccgggagcagggcagccaggtggcgtactgcaacgaccagctcgacgccgccctcaag
gggctctccgccgagcaggtggcccaggtcgtcgtcgcgtacgagccggtctgggcgatc
ggcaccggcaagacggccaccccggaggacgcccaggaggtgtgcggggcgctccgtcag
cggctggccgggcacttcggccaggacacggccgaccaggttcggatcctgtacggcggg
tccgtcaagtcgtccaacgtggcggccatcatggcccagacggacgtggacggggctctt
gtcggcggtgccagcctcgacgccgaggagttcgcgaagatctgccggttcccggagcac
actgccggctga

DBGET integrated database retrieval system