KEGG   Salinispora arenicola: Sare_3395Help
Entry
Sare_3395         CDS       T00613                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
saq  Salinispora arenicola
Pathway
saq00260  Glycine, serine and threonine metabolism
saq00400  Phenylalanine, tyrosine and tryptophan biosynthesis
saq01100  Metabolic pathways
saq01110  Biosynthesis of secondary metabolites
saq01130  Biosynthesis of antibiotics
saq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:saq00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sare_3395
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sare_3395
Enzymes [BR:saq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sare_3395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA
Motif
Other DBs
NCBI-ProteinID: ABV99197
JGI: Sare3395
UniProt: A8LX37
Position
complement(3924093..3924896)
Genome map
AA seq 267 aa AA seqDB search
MSHIGVAFDKARAEGRAVLVGCMPAGFPTVEGSIAAMTAMVEAGVDVIEVEIPYSDPVMD
GPVIQRASDIALAGGVRVADTLRIIEAVAATGVPVVTMTYWNPVEQYGVDAFARDLAAAG
GTGLITPDLIPDEAQEWLAASDAHGLDRTFLVAPSSTDTRLEMTVEHCRGFVYATALMGV
TGARTQASAAAPVLVSRVRGVTDLPVGVGLGTGTGAQASTVAGFADGVIVGSALIRCLLD
APSLPAGLTALRALSAELAAGVRTPAH
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtgagccacatcggggtcgcgttcgacaaggcccgtgccgaaggccgggcggttctggtc
ggctgcatgcccgccgggtttcccaccgtcgagggcagcatcgccgcgatgaccgccatg
gtcgaggctggcgtggacgtcatcgaggtggagattccctactccgacccggtgatggac
ggaccggtcatccaacgggcgagcgacatcgcactggccggaggggtacgggtcgccgac
accctgcgcatcatcgaggctgtcgccgccaccggcgtgccggtggtgacgatgacctac
tggaatccggtggagcagtacggcgtcgatgcgttcgcccgggacctcgccgcggcgggc
ggcaccgggctgatcacgcccgacctgattcccgacgaggcgcaggagtggctggccgcc
tcggacgcacacgggctggaccggaccttcctcgtcgccccctcctccaccgacacccgg
ctggagatgaccgttgagcactgccgcggtttcgtgtacgcgaccgcgctcatgggggtc
acgggagcccgcacgcaagcttcggcggcggccccggtgctggtgtcccgcgtccggggg
gtcacggacctgccggtgggtgtcgggctcgggaccggcaccggggcacaggccagtacg
gtcgccgggttcgccgacggtgtcatcgtcggtagcgccctgatccgctgcctgctcgac
gccccgagcctgccggcgggcctgaccgccctgcgcgcgttgagtgccgaactcgccgca
ggcgtccgtacccccgcccactga

DBGET integrated database retrieval system