KEGG   Salinispora arenicola: Sare_3396Help
Entry
Sare_3396         CDS       T00613                                 

Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
saq  Salinispora arenicola
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:saq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sare_3396
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sare_3396
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sare_3396
Enzymes [BR:saq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sare_3396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3924901..3926133)
Genome map
AA seq 410 aa AA seqDB search
MSVDTPAATGRYPDAAGHFGRFGGRFVPEALVAALDQLDGAWRTAMVDESFQAEFAALLR
DYAGAPSLLYTAQRLSAEVGARVLLKREDLNHTGAHKVRNVLGQALLTKRMGKRRVIAET
GAGQHGVATATAAALFDLECVVYMGEVDTQRQALNVARMRMLGATVVPVTTGSRTLKDAM
NEAMRDWVANVDSTHYLIGTVAGPHPFPAVVRDFVRGIGDEARQQCLDLTGALPDAVTAC
VGGGSNALGVFHAFVDDPSVRLYGFEAGGDGPATGRHAASITGGSSGVLHGTRTYVLQDA
DGQTIESHSISAGLDYPGVGPEHAWLHDTGRATYLPVTDADAMAAFELLCRTEGIIPAIE
SSHALAGTVAIAPKLAAELGREPVVVVNLSGRGDKDVHTAGEYFGVLDKE
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcgacacgccggctgcgaccggtcggtacccggatgccgccgggcacttcggc
cgcttcggcggcaggttcgtccccgaggccctggtggccgcgttggaccaactcgacggc
gcctggcgtacggcgatggtcgacgagtcgttccaggccgagttcgccgccctgctccgc
gactacgctggcgccccgtcgctgctctacaccgcccagcgtctctccgccgaagtcggg
gcgcgggtgctgctgaagcgggaggacctcaaccacaccggggcgcacaaggtgcgaaac
gtactcggccaggcgttgttgacgaagcggatgggtaagcggcgggtcatcgccgagacc
ggcgccgggcagcacggggtggccaccgccaccgctgccgccctgttcgatctcgagtgt
gtggtctacatgggtgaggtggacacccaacggcaggcgctgaacgtggcgcgaatgcgg
atgctgggcgccaccgtggtgccggtcaccaccgggtcacgaaccctcaaggacgcgatg
aacgaggcgatgcgggactgggtcgccaacgtcgacagcacccactacctgatcggcacg
gtggccggcccgcacccgttccccgccgtggttcgcgacttcgtccggggcatcggcgac
gaggcacgtcagcagtgcctcgacctgaccggtgcgttgcccgacgcggtcaccgcctgt
gtcggtggcggatccaacgcgctcggcgtcttccacgccttcgtcgatgacccgagcgtc
cgcctctacggcttcgaggccggcggcgacgggccggccaccggtcggcacgcggccagc
atcaccggcggatcctcgggggtgctgcacggcacccggacgtacgtgctccaggatgcc
gatggtcagaccatcgagtcgcactcgatctcggccgggctggactatccgggtgtcggg
ccggaacacgcctggctgcacgacaccggccgggcgacgtacctgccggtgaccgacgcc
gacgcgatggcggccttcgagctgctctgtcgcaccgaggggatcatccccgcgatcgag
agttcccacgcgctggccggcacggtcgcgatcgcccccaagctcgccgcggagttggga
cgcgagccggtcgtggtggtcaacctctccggccgcggtgacaaggacgtgcacaccgcc
ggggagtacttcggcgtcctcgacaaggagtga

DBGET integrated database retrieval system