KEGG   Salinispora arenicola: Sare_3443Help
Entry
Sare_3443         CDS       T00613                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
saq  Salinispora arenicola
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:saq00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Sare_3443
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sare_3443
Enzymes [BR:saq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Sare_3443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3969425..3970972)
Genome map
AA seq 515 aa AA seqDB search
MSGKPRPRRVTGIRLGDLADRLAAEPDAGTVNLRPGPSEPTVTGVTHASQEVRPGDLYAA
LPGARRHGAEFVPAAARAGAVAVLTDPAGASATAQAGLPMLVVPDPRAVLGDLASAVYGD
PTAGLAVIGVTGTAGKTSTAYLVESGLRAAGHVTGLIGTVETRLGDLAMDSVRTTPEATD
LHAMLAAARERGVTAVVMEVSSHALAMGRVGGVRFTVGGYTNFGSDHLDFHVDSADYFAA
KAKLFDGRCEVEVLNHDDPALRPLYRQATVTYSAAGDRSATWWADAVGGEGYAQRFTLHG
PDGLALPAGVALPGRHNVANALLAIAVLVAAGVDAKTAAAGVAACGGVPGRLELVRAPGP
VRGVVDYAHKTDAIVAALAALREFGAGRRLICLLGAGGDRDRGKRPLMGIAAAEGADVVV
VTDDNPRTEEPAEIRAEVLAGAYRAGTDARVLEVPGRRAAIAEAVRLAEPGDVVALLGKG
HEQGQEVDGEVQPFDDRTELAAALRARFGERAGQS
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
gtgtccggcaaacctcgccctcgtcgcgtgaccggaatccggctcggtgacctcgccgat
cggctcgccgccgagcccgacgcgggcaccgtcaaccttcggcctggtccttcggagccg
acggtcaccggggtaacgcacgccagccaggaggtccgccccggcgacctgtacgcggcc
ctgcccggtgcccggcgacacggcgccgagttcgttccggccgcggcccgggccggcgcg
gtggccgtgctgaccgatccggccggcgcgtcggcgacggcccaggccggtctgcccatg
ctggtggtgccggacccgcgggctgtgctgggcgatctggccagtgcggtgtacggtgac
ccgaccgcggggctggccgtgatcggggtgaccggaaccgccggcaagacgtcaacggcg
tacctggtcgagtccgggttgcgcgcggccggacacgtcaccggcctgatcggcaccgtc
gagacccgcctcggtgacctggcgatggacagcgtccggaccacgcccgaggcgaccgac
ctgcacgccatgctcgccgccgcccgggagcgcggcgtcaccgccgtggtcatggaggtg
tccagtcacgccctggccatggggcgggtcggtggcgtccggttcaccgtcggcggctac
accaacttcggctccgaccacctcgacttccacgtcgactccgcggactacttcgccgcc
aaggcgaagctcttcgacggccgctgtgaggtggaggtactcaaccacgacgatccggcg
ttgcgccccttgtacagacaggccacggtgacctactcggcggccggcgaccggtccgcg
acctggtgggccgacgcggtcggcggcgaggggtacgcgcagcgcttcacgctgcacgga
ccggacgggctggccctacccgccggggtggccctgcctggccggcacaacgtcgccaac
gcactgctcgccatcgccgtgctggtcgccgccggggtggacgcgaagaccgccgccgcc
ggggtggcagcctgcggtggcgtccccggccggctggagctggtccgggctcccggcccg
gtgcgtggcgtcgtcgactacgcgcacaagaccgatgcgatcgtcgccgcgctggccgcc
ctgcgggagttcggcgctgggcgacggcttatctgcctactcggcgccggcggcgaccgg
gaccggggcaagcggcccctgatgggcatcgccgccgcggagggagcggacgtcgtggtg
gtgaccgatgacaatccacggaccgaggaacccgccgaaatccgcgccgaggtgctcgcc
ggggcgtaccgggccggcaccgacgcccgggtcctggaggtgcccggtcggcgcgcggcc
atcgcggaggcggtccggctcgcggagcccggggacgtggtggcgctgctgggcaagggg
cacgagcaggggcaggaggtcgacggggaggtgcagcccttcgacgatcgcaccgagctg
gccgccgcgctgcgggctcggttcggtgagcgggcagggcagtcatga

DBGET integrated database retrieval system