KEGG   Salinispora arenicola: Sare_3506Help
Entry
Sare_3506         CDS       T00613                                 

Definition
(GenBank) putative glucokinase, ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
saq  Salinispora arenicola
Pathway
saq00010  Glycolysis / Gluconeogenesis
saq00052  Galactose metabolism
saq00500  Starch and sucrose metabolism
saq00520  Amino sugar and nucleotide sugar metabolism
saq00521  Streptomycin biosynthesis
saq01100  Metabolic pathways
saq01110  Biosynthesis of secondary metabolites
saq01120  Microbial metabolism in diverse environments
saq01130  Biosynthesis of antibiotics
saq01200  Carbon metabolism
Module
saq_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:saq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sare_3506
   00052 Galactose metabolism
    Sare_3506
   00500 Starch and sucrose metabolism
    Sare_3506
   00520 Amino sugar and nucleotide sugar metabolism
    Sare_3506
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sare_3506
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Sare_3506
Enzymes [BR:saq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Sare_3506
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG DUF1464 FGGY_N
Motif
Other DBs
NCBI-ProteinID: ABV99308
JGI: Sare3506
UniProt: A8LYA0
Position
complement(4045043..4045990)
Genome map
AA seq 315 aa AA seqDB search
MTLTIGVDVGGTKVAAGVVDDTGTVLVQTRRDTPADDVGKTCDVIVEVIRELAAGRAIEG
VGIGAAGWIDASRSTVLFAPNLAWRDEPLREFVSAATDLPVIVENDANVAAWGEFRYGAA
RDADDSMVMFTIGTGVGGGIVLGGELVRGAHGIAAELGHMLSVPDGHQCGCGRLGCIEQY
ASGSALVRFAQAAARQEPNRAAALLGQAGGDVDAITGRMVTAAARDGDPVSTEAFAQVGH
WLGSGLADMAQILDPQVLVVGGGVVEAGELLLGPTRCSFTEALAQRCRLPVAQISPAKLG
NDAGLIGAADLARRV
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
gtgacgctgaccatcggagtggacgtcggtggcacgaaggtcgcggccggcgtcgtggac
gacacgggcacggtgctcgtgcagacccgacgggacactcccgcggacgatgtcggcaag
acctgcgacgtcatcgtcgaggtgatccgggaactggccgctggccgtgcgatcgagggg
gtcggcatcggcgcggccgggtggattgacgccagccgatcaaccgtgctcttcgccccg
aaccttgcctggcgtgacgagccgctgcgcgagttcgtcagtgcagccaccgacctgccg
gtgatcgtggagaacgacgccaacgtggcggcctggggggagttccgctacggagcggcc
cgtgacgccgacgactcgatggtcatgttcaccatcggcaccggggtcggtggcggcatc
gtgcttggcggcgagttggttcgcggcgcgcatggtatcgccgctgaactgggacacatg
ctcagtgtgccggacgggcaccagtgcggctgcggccggctgggctgcatcgagcagtac
gccagcgggagcgccctggtgcggttcgcccaggctgccgctcgccaggaaccaaaccgc
gccgccgccctgctggggcaggccggtggcgacgtcgacgcgatcaccggccgaatggtc
accgccgctgcgcgggacggcgacccggtctccaccgaggctttcgcccaggtcggccac
tggctcggcagcggtctcgccgacatggcgcagatcctcgatccgcaggtgttggtggtc
ggcggtggcgtcgtcgaagccggtgaactgctgctgggcccgacccgctgctccttcacc
gaggcgctcgcgcagcgttgtcggctgccggtggcgcagatcagccccgccaagctcggc
aacgacgctggtctcatcggcgccgccgacctcgcccgccgggtctag

DBGET integrated database retrieval system