KEGG   Salinispora arenicola: Sare_3552Help
Entry
Sare_3552         CDS       T00613                                 

Definition
2-oxoglutarate dehydrogenase E2 component (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
saq  Salinispora arenicola
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:saq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sare_3552
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sare_3552
  Amino acid metabolism
   00310 Lysine degradation
    Sare_3552
Enzymes [BR:saq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Sare_3552
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4097361..4099133
Genome map
AA seq 590 aa AA seqDB search
MPVSVTMPRLGESVTEGTVTRWLKQEGDTVEVDEPLLEVSTDKVDTEIPSPAAGVLTRIV
VGEDETAEVGSELATIGDEASSGGGAAPQQPATSAPEPTAAAEGNGPEPAQPAEEQPAPA
PSGEGTPVTMPALGESVTEGTVTRWLKQVGETVEVDEPLLEVSTDKVDTEIPSPVAGTVL
EITVAEDETADVGATLAVVGAAGATPKAEPKPEPKAAAPAPKPEPEVTEPTPGVSYNEPA
AETEVAAEPAKAEQAAAPSAPAPQPSGTGGAETPGYVTPLVRKLAGEHGVDLATVNGTGV
GGRIRKQDVLDAAEQARAAKAAPAPAAEPTPAAQPAPAAPKPAARPAPSSKRGATEKLPR
IRATIAKRMHESLHEMAQLTTVVEVDVTRIAKLRAQAKDSFQQRHGVKLSFLPFFALAAV
EALQAYPIVNAQMDLAAGTITYPEAEHLGIAVDTERGLMVPVIHNAGDLNLGGIAKRVSD
LAERTRTNKISPDELAGATFTLTNTGSRGALFDTPIVPSPQSAMLGTGAVVKRPVVVNDP
ELGEVVAVRSMIYLALSYDHRLIDGADAARFLGAIKERLEAGNFEAELGR
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgccggtatcggtcaccatgccccggctcggtgaaagcgtcaccgagggcaccgtcacg
cgctggctcaagcaggagggcgacaccgtcgaggttgacgagccgctgctcgaggtgtcg
accgacaaggtggacaccgagatcccgtcccccgcggccggcgtgctgacccggatcgtg
gtcggcgaggacgagaccgccgaggtcggcagcgagctggcgacgatcggcgacgaggcg
tcgagtggcggcggggccgcgccacagcagccggccacgtcggcacccgagccgaccgcc
gccgctgaggggaacggcccggagccggcgcagcccgccgaggagcagccggctcccgcg
ccgtcgggcgagggtaccccggtgacgatgccggccctcggcgagagcgttaccgagggc
acggtcacccgctggctcaagcaggtcggcgagaccgtggaggtcgacgagccgctgctc
gaggtgtcgaccgacaaggtggacaccgagatcccgtcgccggtcgctgggaccgtcctg
gaaatcaccgtcgcggaggacgagacggcggacgtcggcgcgacgctggcggtcgtcggc
gcggccggtgccacgccgaaggccgagccgaagcctgagccgaaggcggcggcccccgca
ccgaagcccgagccggaggtcaccgagccgaccccgggggtgtcctacaacgagccggcg
gcggagaccgaggtcgccgccgaaccggcgaaggccgagcaggccgccgccccgtccgcg
cccgccccgcagccgtcgggaaccggcggtgcggaaaccccgggatacgtcaccccgctg
gtccgcaagctggccggtgagcacggggtcgacctggccacggtcaacggcaccggcgtc
ggtggccggatccggaagcaggacgtcctcgacgccgccgagcaggcccgcgcggccaag
gcggctccggccccggctgcggagcccaccccggcggcgcagcccgccccggcggcgccg
aagccggctgcccggcccgcgcccagcagcaagcggggcgccaccgagaagctgccccgg
atccgcgcgaccatcgcgaagcggatgcacgagtcgctgcacgagatggcgcagctcacc
accgtggtcgaggtcgacgtcacccggatcgccaagctgcgggcccaggcgaaggactcg
ttccagcagcggcacggcgtgaagctgtccttcctgccgttcttcgctctggccgccgtc
gaggcgttgcaggcgtacccgatcgtcaacgcccagatggacctggcggccgggacgatc
acctacccagaggcggagcacctcggcatcgccgtggacaccgagcggggcctgatggtg
ccggtcattcacaacgccggcgacctcaacctcggtggcatcgccaagcgggtctccgac
ctggccgagcgcacccgtaccaacaagatcagcccggatgagctcgctggtgcgacgttc
acgctgaccaacaccggcagccggggcgccctcttcgacaccccgatcgtgccgtcgccg
cagtcggcgatgctcggcacgggtgccgtggtcaagcgcccggtcgtggtcaacgacccg
gaactgggcgaggtcgtggccgtccggtcaatgatctacctggccctgtcgtacgaccac
cgactgatcgacggtgccgacgcggcccgtttccttggcgcgatcaaggaacggctggag
gccggcaacttcgaggccgaactgggccggtag

DBGET integrated database retrieval system