KEGG   Salinispora arenicola: Sare_3626Help
Entry
Sare_3626         CDS       T00613                                 

Definition
(GenBank) glycoside hydrolase family 3 domain protein
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
saq  Salinispora arenicola
Pathway
saq00520  Amino sugar and nucleotide sugar metabolism
saq01100  Metabolic pathways
saq01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:saq00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Sare_3626
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Sare_3626
Enzymes [BR:saq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Sare_3626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C
Motif
Other DBs
NCBI-ProteinID: ABV99424
JGI: Sare3626
UniProt: A8LZ64
Position
complement(4183114..4184841)
Genome map
AA seq 575 aa AA seqDB search
MPTPSQHGGVVVVALAVLTSLLLAGCTGGRGRAQPTPAASDPTAGPSPSVPVTDPGARAA
TLAGSLADEDLVGQVLMPFAYGDAADRVSSGSAAGNQKLAGVDTPAQMIAKYRLGGLILV
GFSADDPTSGNQETTNVDNPDQVRGLTAGLRSVAADLATGEAPFLIGTDQEYGVVTRITE
GVTQLPSALAAGAAGKPDLTEAAWQAAGTELAAMGVNVDFAPVADVLVTPSTVIGSRSYG
ADPSAVAAQVSGAVRGLQSAGVAATLKHFPGHGHSATDSHEALPRLEQPRAVLELEAWSP
FAAGIGAGALAVMSGHLDVRAVDPGTPATFSHTLLTEVLRGQLGFQGVVITDGMNMAPAK
RWSPGEAAVRALKAGNDLILMPPHVGQAYDGLLAALRDGSLPRTRLVEAVTRVLTMKFTL
AGAATPALDVIGTPAHLAAATELATAAVTALRGQCGSLVSGPITVTASAGRKHTRAVLIK
ELTAAGVPVVDTGGAVVHLVGYGDGTDDLSADAAVTVAMDTPYLLAEADSPALLATYSSS
PAAMTGLARVLAGTATPAGRSPVPVPGLPATSCGN
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
gtgccgacaccctcgcaacacggcggcgtcgtagtcgtcgcactggccgtcctgacctcg
ctgctgctcgccggctgcaccggcgggcgggggcgcgcacagccgactccggcggcgagt
gacccgacggcaggcccgtcaccctcggtcccggtcactgatccgggcgcccgcgccgcc
accctggcgggctcgctggctgacgaggacctcgtcggccaggtgctgatgcccttcgcc
tacggcgacgccgccgatcgggtctcgtccggttcggccgccggtaaccagaaactcgcc
ggcgtcgacactccggcccaaatgatcgcgaagtaccgcctcggcgggctcattctcgtc
ggcttcagcgcggacgacccgaccagcggcaatcaggagaccaccaacgtcgacaacccc
gaccaggtccgggggctgaccgccgggctgcggtccgtcgccgccgacctggccaccggc
gaggcgccgttcctgatcggcacggatcaggagtacggggtggtcacccggatcaccgag
ggcgttacgcagctgcccagcgcgttggccgccggggcggccggcaagcctgacctgacc
gaggccgcctggcaggccgccggcaccgaactcgccgcgatgggcgtcaacgtggacttc
gcccccgtcgccgacgtgctcgtcacgccgagcaccgtgatcggctcacggtcgtacggt
gccgacccgtcggcggtggccgcacaggtcagcggtgcggtacgcggcctgcagtcggcc
ggtgtcgcggccaccctcaaacatttccccggccacgggcacagcgccaccgactcccac
gaggcactgccgaggttggaacagccccgcgccgtactcgagttggaggcatggagtccc
ttcgcggccggcatcggggccggtgccctcgcggtgatgtccgggcacctcgacgtccgt
gcggtcgacccggggaccccggcgacgttctcgcacaccctcctcaccgaggtgctccgc
ggtcagctcggcttccagggcgtcgtgatcaccgacgggatgaacatggcgcccgccaag
cgctggtcgcccggcgaggccgcggtgcgtgccctcaaggccggcaacgacctgatcctg
atgccgccgcacgtcggccaggcgtacgacgggctgctcgccgcgctgcgcgacggctcg
ctgccccggacccggctggtcgaggcggtgacccgcgtgttgaccatgaagttcaccctg
gccggtgcggccacccccgcgctggacgtcatcggtacgccagcccacctggcggcggcc
accgaactcgccaccgccgcggtgaccgcactgcgtggccagtgtggcagcctggtgtcc
gggccgatcaccgtgaccgcctccgccggccggaagcacacccgggcggtgctgatcaag
gagctgaccgcggccggggtgccggtggtcgacaccggcggtgccgtggtccacctggtc
ggctacggcgacggcaccgacgacctgagcgccgacgccgccgtgaccgtcgccatggac
accccgtacctgctggccgaggcggattccccggcgctgctggcgacctactcgtcgagc
ccggcggcgatgaccgggctggcccgggtgctggccggtacggccacccccgccggccgt
tcgccggtgccggtgcccggcctgcccgcgacgagctgcggcaactga

DBGET integrated database retrieval system