KEGG   Salinispora arenicola: Sare_3901Help
Entry
Sare_3901         CDS       T00613                                 

Definition
(RefSeq) acetaldehyde dehydrogenase
  KO
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
saq  Salinispora arenicola
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:saq00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Sare_3901
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sare_3901
   00650 Butanoate metabolism
    Sare_3901
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Sare_3901
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Sare_3901
   00622 Xylene degradation
    Sare_3901
   00621 Dioxin degradation
    Sare_3901
Enzymes [BR:saq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Sare_3901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4441498..4442424)
Genome map
AA seq 308 aa AA seqDB search
MSVGVAVLGSGNIGTDLMIKVLRLSDSLRMVAMAGIDSGSDGLARARRLGVTTTADGVAG
LVTLPEFADVELVFDATSAGAHRHHDSVLRAYGRIVVDLTPAAIGPYVVPPVNLDEHLAE
TNVNMVTCGGQATVPIVAAIGRVTPVAYGEIVASIASKSAGPGTRANIDEFTETTARAIE
VVGGADRGKAIIVLNPADPPLLMRDTVYCLCPDTDADRSAIIAAVTDMVGAVQEYVPGYR
LKQEVQFDRVDSYLPALGGHLTGLQVSVFLEVSGAGHYLPEYAGNLDIMTSAALRTAERL
IGRRAVTA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtcggggtggcagtgctcggttccgggaacatcggaaccgacttgatgatcaag
gttttgcgactcagcgacagcctgcggatggtcgccatggcgggcatcgattcgggctcc
gacgggctggcccgagcccggcggctcggtgtcaccacgaccgccgacggggtggcgggg
ctcgtgacgttgcccgagttcgccgacgtggagttggtcttcgacgccacgtcggccggg
gcccaccggcaccacgactccgtgctgcgtgcctacggtcggatcgtggtcgacctgacc
cccgccgcgatcgggccgtacgtggtgccgccggtcaatctcgacgagcacctggcggag
accaacgtcaacatggtcacctgtggtgggcaggcgaccgtgccgatcgtcgccgccatc
ggccgggtcaccccggtcgcgtacggggagatcgtcgcctcgatcgcctcgaaatccgcc
gggccaggcacccgggccaacatcgacgagttcaccgagaccaccgcccgggcgatcgag
gtggtcggtggtgccgatcggggcaaggccatcatcgtgctgaacccggccgacccgccg
ctgctgatgcgggacaccgtgtactgcctctgcccggacaccgacgcggaccggagcgcg
atcatcgccgcggtcaccgacatggtgggcgctgtgcaggagtacgtccccggctaccgg
ctcaagcaggaggtgcagttcgaccgggtggacagctacctgccggcgctcggtgggcac
ctcaccggcctacaggtctcggttttcctggaggtctccggtgccgggcactacctgccc
gagtacgccgggaacctggacatcatgacctcggccgccctgcgtaccgcagagcggctg
atcggccggcgggcggtgacggcatga

DBGET integrated database retrieval system