KEGG   Salinispora arenicola: Sare_4134Help
Entry
Sare_4134         CDS       T00613                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
saq  Salinispora arenicola
Pathway
saq00300  Lysine biosynthesis
saq01100  Metabolic pathways
saq01120  Microbial metabolism in diverse environments
saq01230  Biosynthesis of amino acids
Module
saq_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:saq00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Sare_4134
Enzymes [BR:saq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Sare_4134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ABV99924
JGI: Sare4134
UniProt: A8M3G1
Position
complement(4697722..4698795)
Genome map
AA seq 357 aa AA seqDB search
MENPLTPEVLADPVALTRALVDIESVSRHEKAIADCVEQVLRGVPHLTTYRHGNTVMART
DLGRAQRVVLAGHLDTVPINNNFPATVRGDLMYGCGTSDMKSGVAYALHLAVTLPEPRYD
VTYFFYEAEEIESTYNGLFLVSEAYPDWLSADFALLLEPTHGIVEAGCQGTLRATVATSG
VRAHSARSWYGVNAIHAAVDVLRRLEAYEARRTTIEGCEYREGMNAVRIEGGVAGNVVPD
RCVVEVNFRFAPDRTPEQAEAHVREVFAGFEVTITDLAAGALPGLEAAPAQEFLAAVGTA
PIGKLGWTDVARFAALGTPALNFGPGDPNLAHHPDEHVEIGKIRDGAAVLRRWLSVA
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggagaacccgctgacccccgaggtcctcgctgatccggtggccctgacccgcgctctg
gtcgacatcgagtccgtatcccgccacgagaaggcaatcgcggactgtgtcgagcaggtg
ctgcgcggggtgccgcatctgaccacctaccggcacggcaacaccgtgatggcccggacc
gacctcggccgggcccagcgggtggtgctcgccgggcacctcgacacggttccgatcaac
aacaatttccccgccacggtgcgcggcgacctgatgtacggctgcggcacctcggacatg
aaaagtggtgtcgcgtacgcgttacacctcgcggtgaccctgcccgagccgcggtacgac
gtgacgtacttcttctatgaggcggaggagatcgagtcgacgtacaacggtctgttcctc
gtctccgaggcgtacccggactggctgtcggccgacttcgcgctgctgttggaaccgaca
cacgggatcgtcgaggcgggctgccagggcacgttgcgggccaccgtcgccaccagtggc
gtacgggcgcactcggcgcgttcctggtacggcgtcaacgcgatccacgccgcggtggac
gtgttgcgtcggctcgaggcgtacgaggcccgtcggaccactatcgagggttgcgaatac
cgagagggtatgaacgcggttcggatcgagggtggggtcgccggcaacgtggtgccggac
cgctgcgtggtcgaggtcaacttccggttcgcgccggaccgtacccccgagcaggccgag
gcgcacgtgcgtgaggtgttcgctggcttcgaggtgacgatcaccgacctggcggccggt
gcgctgccgggcctggaagctgcgccagcgcaggagttcctggcggctgtcggcactgcg
cccatcggcaagctgggctggacggacgtggcccggttcgccgcgttgggcaccccggcg
ttgaacttcggcccgggcgaccccaaccttgcgcaccacccggatgagcacgtcgaaatc
ggcaagatccgcgacggcgcggccgttctgcgtcgctggctctcggtcgcctga

DBGET integrated database retrieval system