KEGG   Salinispora arenicola: Sare_4262Help
Entry
Sare_4262         CDS       T00613                                 

Definition
bifunctional uroporphyrinogen-III synthetase/response regulator domain-containing protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
saq  Salinispora arenicola
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:saq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sare_4262
Enzymes [BR:saq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Sare_4262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4836938..4838026
Genome map
AA seq 362 aa AA seqDB search
MRDELAGFTVGVTADRRRDELAALLQRRGARVVFAPALRIVPLADDTELRAATRACLERP
PDVLMADTGIGMRGWLEAAEGWGLAEPLRAALSGAYVVARGPKARGAIRAAGLHDQWSPA
SESCAEVVEHLRERGVAGQVIAMQLHGGRQPECTSALMAAGATVIEVPVYRWAPPTDPAP
LHRLIDLVAGRLVDAVTFTSAPAAEALLRAAGDRTDRVLDAFRGTVLASCVGTVTAEPLR
RRGVPVSAPQRARLGALVRTIVAELPRRTVTLKAAGHLLTLRGHAAVVDGELRPLAPAPM
AVLRTLAASPGRVLSRAALLRTLPRGADEHAVEMAVARLRAGLKAPGVVQTVVKRGYRLR
VE
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgacgaactggccggcttcaccgtcggggtgaccgccgaccgacgtcgggatgag
ctggcggcgctacttcaacgacgtggggcccgggtggtcttcgcacccgccctgcggatc
gtgccgctcgccgacgacaccgagctgcgcgcggcgacgcgggcctgtttggagcgaccg
ccggacgtcctgatggccgataccgggatcgggatgcgtggctggctggaggccgccgaa
ggctgggggctggccgagccgctgcgcgcggcgctcagcggagcgtatgtggtggcgcga
ggcccgaaggcccggggagcgatccgggcagccggcctgcacgatcagtggtcacctgcc
tcggagagctgcgccgaggtggtggagcacctacgtgaacgtggcgttgccggccaggtg
atcgccatgcagctgcacggcgggcggcaacccgagtgcacgagcgcgctgatggccgcc
ggggcgaccgtcatcgaggtgccggtctaccgctgggcaccaccgaccgacccggcacca
ctgcaccggctgatcgacctggtcgccggccggctggtggacgcggtgacgttcacctcg
gctcccgctgccgaagcgctgctacgcgccgccggggaccgtaccgaccgggtgctcgac
gcgttccgcggcaccgtgctggcgagctgcgtggggacggtgaccgcggagccgctgcgg
cggcgaggggtgccggtcagcgcgccgcaacgggcccggctgggcgccttggtccgcacg
atcgttgccgagttaccccgacgaacggtcaccctgaaggctgctggtcatctactgacc
ctgcgtggccatgctgccgtggtcgacggtgagctacggccgctggcacctgccccgatg
gcggtgctgcggacgctggccgcgtccccaggccgtgtcctgtcgcgggctgcgctactg
cggacactgccgcgcggggcggacgagcatgcggtggagatggcggtggcgcggctacgc
gccgggttgaaggcccccggggtggtgcagacggtggtgaagcgcggctaccgcctccga
gtcgaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system