KEGG   Salinispora arenicola: Sare_4262Help
Entry
Sare_4262         CDS       T00613                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
saq  Salinispora arenicola
Pathway
saq00860  Porphyrin and chlorophyll metabolism
saq01100  Metabolic pathways
saq01110  Biosynthesis of secondary metabolites
saq01120  Microbial metabolism in diverse environments
Module
saq_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:saq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sare_4262
Enzymes [BR:saq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Sare_4262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: ABW00044
JGI: Sare4262
UniProt: A8M4C8
Position
4836938..4838026
Genome map
AA seq 362 aa AA seqDB search
MRDELAGFTVGVTADRRRDELAALLQRRGARVVFAPALRIVPLADDTELRAATRACLERP
PDVLMADTGIGMRGWLEAAEGWGLAEPLRAALSGAYVVARGPKARGAIRAAGLHDQWSPA
SESCAEVVEHLRERGVAGQVIAMQLHGGRQPECTSALMAAGATVIEVPVYRWAPPTDPAP
LHRLIDLVAGRLVDAVTFTSAPAAEALLRAAGDRTDRVLDAFRGTVLASCVGTVTAEPLR
RRGVPVSAPQRARLGALVRTIVAELPRRTVTLKAAGHLLTLRGHAAVVDGELRPLAPAPM
AVLRTLAASPGRVLSRAALLRTLPRGADEHAVEMAVARLRAGLKAPGVVQTVVKRGYRLR
VE
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgacgaactggccggcttcaccgtcggggtgaccgccgaccgacgtcgggatgag
ctggcggcgctacttcaacgacgtggggcccgggtggtcttcgcacccgccctgcggatc
gtgccgctcgccgacgacaccgagctgcgcgcggcgacgcgggcctgtttggagcgaccg
ccggacgtcctgatggccgataccgggatcgggatgcgtggctggctggaggccgccgaa
ggctgggggctggccgagccgctgcgcgcggcgctcagcggagcgtatgtggtggcgcga
ggcccgaaggcccggggagcgatccgggcagccggcctgcacgatcagtggtcacctgcc
tcggagagctgcgccgaggtggtggagcacctacgtgaacgtggcgttgccggccaggtg
atcgccatgcagctgcacggcgggcggcaacccgagtgcacgagcgcgctgatggccgcc
ggggcgaccgtcatcgaggtgccggtctaccgctgggcaccaccgaccgacccggcacca
ctgcaccggctgatcgacctggtcgccggccggctggtggacgcggtgacgttcacctcg
gctcccgctgccgaagcgctgctacgcgccgccggggaccgtaccgaccgggtgctcgac
gcgttccgcggcaccgtgctggcgagctgcgtggggacggtgaccgcggagccgctgcgg
cggcgaggggtgccggtcagcgcgccgcaacgggcccggctgggcgccttggtccgcacg
atcgttgccgagttaccccgacgaacggtcaccctgaaggctgctggtcatctactgacc
ctgcgtggccatgctgccgtggtcgacggtgagctacggccgctggcacctgccccgatg
gcggtgctgcggacgctggccgcgtccccaggccgtgtcctgtcgcgggctgcgctactg
cggacactgccgcgcggggcggacgagcatgcggtggagatggcggtggcgcggctacgc
gccgggttgaaggcccccggggtggtgcagacggtggtgaagcgcggctaccgcctccga
gtcgaatga

DBGET integrated database retrieval system