KEGG   Salinispora arenicola: Sare_4434Help
Entry
Sare_4434         CDS       T00613                                 

Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
saq  Salinispora arenicola
Pathway
saq00010  Glycolysis / Gluconeogenesis
saq00620  Pyruvate metabolism
saq00640  Propanoate metabolism
saq00680  Methane metabolism
saq01100  Metabolic pathways
saq01110  Biosynthesis of secondary metabolites
saq01120  Microbial metabolism in diverse environments
saq01130  Biosynthesis of antibiotics
saq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:saq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sare_4434
   00620 Pyruvate metabolism
    Sare_4434
   00640 Propanoate metabolism
    Sare_4434
  Energy metabolism
   00680 Methane metabolism
    Sare_4434
Enzymes [BR:saq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Sare_4434
Lipid biosynthesis proteins [BR:saq01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Sare_4434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N MlrC_C
Motif
Other DBs
NCBI-ProteinID: ABW00209
JGI: Sare4434
UniProt: A8M5Z3
Position
5007852..5009837
Genome map
AA seq 661 aa AA seqDB search
MSEALANLLNETRQFPPPPGLAANANVTGEAYAAADADRLAFWEQQARRLAWAKQWDRVL
DWSEPPFARWYVGGQLNVAYNCLDRHVEAGRGERVAIHWEGEPGDVRTITYAELHRLTCQ
AANALTDLGVTAGDRVAIYLPMVPEAAVAMLACARIGATHSVVFGGFSADALTNRIQDAA
AKVVITADGGYRRGRPSALKPTVDEAVSNCPSVEHVLVVRRTGEEVAWSGKDRWWHETVE
RAPVEHQAVAFDAEHPLFILYTSGTTARPKGILHTTGGYLTQASYTMHAVFDLKPDTDVY
WCTADVGWVTGHSYIVYGPLSNGATQVMYEGTPDTPHRGRFWEIVDKYRVTILYTAPTLI
RTMMKWGEDIPAGFELSSLRLLGSVGEPINPEAWMWYRQHVGRGELPIVDTWWQTETGAI
MISPLPGVTHAKPGSAMTPLPGINGDVVDDQGQPVPNGGGGYLVVREPWPSMLRTIWGDD
NRFVETYWSRFGAGAGAGDDWVYFAGDGAKKDDDGHIWLLGRVDDVMLVSGHNISTTEVE
SALVSHPSVAEAAVVGATDPTTGQAIVAFAIPRGSTETGGTAGARLIADLRDHVARTLGP
IAKPRQILLVPELPKTRSGKIMRRLLRDVAENRSLGDVTTLQDSSVMDLISAGMGTGKGE
D
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaggcgttggccaatctgttgaacgagacgcgccagttcccgccgccgcccgga
ctcgccgcgaacgccaacgtcaccggcgaggcgtacgccgcggcggacgccgaccggctg
gcgttctgggaacagcaggcccggcgactggcctgggcgaagcagtgggatcgggtgctc
gactggtccgagccaccgttcgcgaggtggtacgtcggcggtcagctcaacgtggcgtac
aactgcctcgaccggcatgtcgaggccggccggggtgagcgggtcgccatccactgggag
ggcgagccgggtgacgtccgcacgatcacctacgcggagttgcacaggctcacctgccag
gcggcgaacgcgctgaccgatctcggggtgaccgctggcgaccgggtggcgatctacctg
ccgatggtgccggaggctgcggtggcgatgctggcctgcgcccggatcggtgccacccac
agcgtggttttcggtgggttctccgccgacgcgctgaccaaccggatccaggacgccgcc
gcgaaggtggtgatcaccgccgacggcggctatcggcggggcaggccgtcggcgctcaag
ccgactgtcgacgaggcggtgtcgaactgcccgtcggtggagcatgtgctggtggtccgc
cgcaccggcgaggaggtcgcctggtcggggaaggaccgttggtggcatgagacggtggag
cgggcgcccgtcgagcaccaggccgtggcctttgatgccgagcacccgctgttcatcctc
tacaccagcggcaccaccgcccgcccgaagggcattctgcacaccaccggcggctatctg
acccaggcttcgtacacgatgcatgcggtcttcgacctcaagccggacaccgacgtctac
tggtgcaccgccgacgtcggttgggtcaccggccattcgtacatcgtgtacggtccgctg
tccaacggcgccacccaggtcatgtacgagggcactccggacaccccccaccggggccgt
ttctgggagatcgtggacaagtaccgggtgaccatcctctacaccgccccgaccctgatc
cggacgatgatgaagtggggtgaggacatccccgctgggttcgaactgtcgtcgctacga
ctgctgggcagcgtgggggagccgatcaaccccgaggcctggatgtggtacaggcagcac
gtcgggcggggtgagcttcctatcgtggacacctggtggcagaccgagaccggcgccatc
atgatctctccgctgccgggcgtgacccacgccaagccgggatcggcgatgactccactg
ccggggatcaacggcgacgtggtggacgaccagggccagccggtgcccaacggcgggggc
ggctacctggtggtcagggagccgtggccgtcgatgctccggaccatctggggcgacgac
aaccggttcgtcgagacgtactggtcgcgcttcggcgccggggccggcgcgggtgacgac
tgggtctacttcgccggggacggcgccaagaaggacgacgacgggcacatctggttgttg
ggccgggtcgacgatgtgatgctggtgtccgggcacaacatttccaccaccgaggtggag
tcggcgctggtgtcgcatccgtcggtggccgaggcagcggtggtcggcgcgaccgacccg
accacgggacaggcgatcgtcgccttcgccatcccccgaggcagcaccgaaaccggaggt
acggcgggtgcgcggctcatcgcggacctacgcgaccatgtcgcgcgcacgttgggtccg
atcgcgaagccgcggcagatcttgctcgtgccggagctgccgaagacccgctccggcaag
atcatgcggcggctacttcgggacgtggccgagaaccggtcgctgggcgatgtcacgacc
ctgcaggattcgtcggtgatggacctcatctcagccggcatgggaaccggcaagggcgag
gactga

DBGET integrated database retrieval system