KEGG   Salinispora arenicola: Sare_4610Help
Entry
Sare_4610         CDS       T00613                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
saq  Salinispora arenicola
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:saq00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5230946..5232463
Genome map
AA seq 505 aa AA seqDB search
MADFVGAVDQGTTSTRFMVFDHGGNDVGRHQLEHQQILPRPGWVEHNPVEIWERTQTVIQ
TVLYEHRLTVTDLAALGITNQRETTVVWNRRTGRPYHNAIVWQDTRTDRIASALERSGRG
DIIRRKAGLPPATYFSAGKIQWILDNVDGVREAAERGEAVFGNTDTWLLWNLTGGTDGGV
HVTDPTNASRTMLMNLDTLDWDDELLSFFDIPRAMLPRIRPSSDPDSYGATTARGPFTGS
VPLTADLGDQQAATVGQVCFAPGEAKNTYGTGNFMLLNTGTEIVRSQAGLLTTVCYQFSD
QAPVYALEGSIAVTGSAVQWLRDQLKIINTAGQSEILARQVPDNGGVYFVPAFSGLFAPY
WRSDARGAIVGLSRFNTDAHIARATLESICYQSRDVAEAMAKDSGVPLECLKVDGGVTDN
DLCMQLQADILGVPVSRPVVAETTALGAAYAAGLAVGFWRSTDELRENWNESHRWQPTWP
PEQRQAEYERWKQAVQRTLNWVDVD
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggctgacttcgttggtgcggtggaccagggcaccaccagtacccgtttcatggttttt
gatcacggtggtaacgacgtcggtcgccaccagctcgagcaccagcagatcctgccgcgg
cccggttgggtcgaacacaatccggtggaaatctgggagcggacccagaccgtcatccag
accgtgctctacgagcaccgcctgaccgtcaccgacctcgccgcgctcgggatcaccaac
cagcgtgagaccaccgtggtatggaacaggcgcaccggtcggccctaccacaacgccatc
gtgtggcaggacacccgcaccgaccggatcgcctcggcactggagcgctcgggccggggc
gacatcatccgccgtaaggccggcctgccaccggccacgtacttctccgccggcaagatc
cagtggatcctcgacaacgtcgatggggtccgggaagcagccgagcgtggagaggccgtc
ttcggcaacaccgacacctggctgctgtggaacctgaccggcggcaccgacggcggcgtg
cacgtcaccgatccgaccaacgccagccgcaccatgctgatgaacctggacacgctggac
tgggacgacgaactgctgtcgttcttcgacatcccgcgcgccatgttgccccggatccga
ccatcgtccgacccggactcctacggtgccaccacggcgcgtggtccgttcaccggatcg
gtcccgctcaccgcggacctcggcgaccagcaggcagccaccgtcggtcaggtctgcttc
gccccgggcgaggccaagaacacctacggtacgggcaacttcatgctcctcaacaccggc
acggagatcgtccgctcccaggccggcctactcaccaccgtctgctaccagttcagcgac
caagcgccggtatacgccctggaaggctccatcgcggtcaccggatcagccgtgcagtgg
ctacgcgaccagttgaaaatcatcaacaccgcagggcagagcgagatcctggcccgccag
gtgcccgacaacggcggagtgtacttcgtacccgccttctccggcctgttcgccccgtac
tggcgctccgacgcccgcggcgcgatcgtcggcctgtcccggttcaacaccgacgcccac
atcgcccgggccaccctcgagtcgatctgctaccagagccgagatgtcgccgaggccatg
gccaaagactccggcgtaccgctggaatgtctcaaggtcgacggcggcgtcaccgacaac
gacctgtgcatgcaactgcaagccgacatcctcggcgtaccggtaagccggcccgtggtc
gccgagaccaccgcgctcggcgccgcgtacgccgccggcctcgccgtcggattctggcgc
agcaccgacgaactacgcgagaactggaacgaaagccaccgctggcagcccacctggcca
ccagaacaacgccaagccgagtacgaacgctggaagcaggccgtccaacgcaccctcaac
tgggtcgacgtcgactga

DBGET integrated database retrieval system