KEGG   Salinispora arenicola: Sare_4775Help
Entry
Sare_4775         CDS       T00613                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
saq  Salinispora arenicola
Pathway
saq00010  Glycolysis / Gluconeogenesis
saq00052  Galactose metabolism
saq00500  Starch and sucrose metabolism
saq00520  Amino sugar and nucleotide sugar metabolism
saq00521  Streptomycin biosynthesis
saq01100  Metabolic pathways
saq01110  Biosynthesis of secondary metabolites
saq01120  Microbial metabolism in diverse environments
saq01130  Biosynthesis of antibiotics
saq01200  Carbon metabolism
Module
saq_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:saq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sare_4775
   00052 Galactose metabolism
    Sare_4775
   00500 Starch and sucrose metabolism
    Sare_4775
   00520 Amino sugar and nucleotide sugar metabolism
    Sare_4775
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sare_4775
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Sare_4775
Enzymes [BR:saq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Sare_4775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Hydant_A_N BcrAD_BadFG Pan_kinase FGGY_N
Motif
Other DBs
NCBI-ProteinID: ABW00529
JGI: Sare4775
UniProt: A8M8L0
Position
complement(5404434..5405399)
Genome map
AA seq 321 aa AA seqDB search
MIQPEGRCVLAVDVGGTTIKAAVVGEDGRFLSSLTAPSQADDDPVEAIRSLCRELRAHAL
SLGSTPAAIGVVTPGLVDERDGVVRYAANLRLRDVPLRALVGGDLGLPVVVGHDARAAGI
AEATAGAAVGLDNFLLLPLGTGIAAAVVVHGVPVAGATRAAGEVGHMPVYPGGEPCSCGQ
RGCLEVYASAGGMARRYARRVGTSGADSQAIADAVATDPHARAVWNDATQALGTALATLT
LALDPARVVLGGGLAEAGALFLDPVREALHGALAWRNPPPVLRSAFGAQAAQVGAAIMAR
RKAGLSVPDGWGAPDLVPPAA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
gtgatccagcccgaaggccgttgcgtcctcgccgtcgacgtcggcgggacgaccatcaag
gcggcggtggtcggcgaggacggccgattcctgagttccctgaccgcgccgtcgcaggcg
gacgacgacccggtcgaggcgatccggtcgctgtgccgcgaactgcgcgcgcatgcgctc
tcgctcggcagcacacccgccgcgatcggcgtggtgacgcccggcctcgtggacgagcgg
gacggagtggtgcggtacgcggcaaaccttcgcctgcgcgacgtgccactgcgcgccctc
gtcggcggcgacctcggactacccgtggtggtcgggcacgacgcgcgggcggccggcatc
gcggaggccacggcgggcgcggccgtcgggttggacaacttcctgctactgccgctgggc
accggcatcgccgcggcggtggtggtccatggtgtccccgtggccggcgcgacccgcgcg
gccggcgaggtcggccacatgccggtctatccgggcggggagccgtgcagttgcgggcag
cggggatgcctggaggtgtacgcctcggccggcgggatggcacgtcgctatgcccggcgc
gtcggcacctcgggggcggacagccaggccatagccgacgcggtggccaccgatccgcac
gcccgtgctgtctggaacgacgccacccaggcgttgggaaccgccctggccaccctcacc
ctggccctcgacccggcccgcgtcgtgttgggaggtgggctcgccgaggcaggcgcactc
ttcctcgacccggtgcgcgaggccctgcacggcgccctcgcctggcggaacccgcccccc
gtgctgcgctccgccttcggcgcccaggcggcacaggtcggcgccgccatcatggcccgg
cggaaggccgggctgtccgttcccgacggctggggtgcgcccgacctcgtgccgccggcc
gcatga

DBGET integrated database retrieval system