KEGG   Salinispora arenicola: Sare_4850Help
Entry
Sare_4850         CDS       T00613                                 

Definition
ribokinase-like domain-containing protein
Orthology
K00882  
1-phosphofructokinase [EC:2.7.1.56]
Organism
saq  Salinispora arenicola
Pathway
Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:saq00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Sare_4850
Enzymes [BR:saq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.56  1-phosphofructokinase
     Sare_4850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5505210..5506220)
Genome map
AA seq 336 aa AA seqDB search
MIVTLTLNPSLDRTIEIEELVRGDVIRATSGSIEPGGKGVNVSRALLANGVPSRALVTCG
GDEGGQLIRLLRSERVDVCALPISGSTRSNITLAEPDGTVTKINEPGPELSATEFSAITD
QVLTEAGAGGCVVVCGSIPPGLPTQEFLSLCERVVAAGDRLVVDTSGPALHAAATAGASL
VKPNREELAQVVGRPLASFADVVDAAQELRSWGAGAVLASLGADGAVLVDADGVIAGAAT
VARPRSSVGAGDALLAGFLAAGGAVSIPVARSGQVEDPESGGQSHHRRNALTEAVAWGAA
AVSLPGSQMPGPADIRREQVRLHSRLTEVQPLLSPS
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtcactctcaccctcaacccgagtctcgaccgcaccatcgagatcgaggaactc
gttcgtggtgacgtcatccgggccacgtcggggagtatcgagccgggcggcaagggcgtg
aacgtgtcccgtgcgctgctggccaacggcgtaccgtcacgggccctggtcacctgcggc
ggggacgagggcggtcagctcatccgcctcctgcgcagtgagcgggtcgacgtgtgcgcg
ctgccgatatccggtagtacgcggtcgaacatcaccctcgccgagccggacggcacggtt
acgaagatcaacgagccggggccggaactcagtgccacggagttctccgcgatcaccgac
caggtgctcaccgaggccggtgccggcggctgcgtggtggtctgtgggagcatcccgcca
ggtctgcccacccaggagttcctcagcctctgcgagcgggtcgtcgccgccggtgaccgg
ctggtggtggacaccagcgggcctgccctccacgctgccgcgacggcgggcgccagcctg
gtcaagcccaaccgggaggaactcgcccaggtggtcgggcgtccgctggcctccttcgcg
gacgtggtcgacgccgcgcaggagctccgctcctggggggccggcgcagtgctggccagt
ctcggggcggacggggccgtcctcgtcgacgccgacggggtcatcgccggcgcggcgacc
gtggcacgtccacgcagttcggtcggcgccggcgacgccctcctggccggcttcctcgcc
gccggtggcgcggtctccatccccgttgcccggtccggccaggtcgaggatcccgagtcg
ggtgggcagtcacaccaccggcggaacgcgctgaccgaggccgtcgcctggggtgccgcc
gccgtgagtctgcccggcagccagatgcccggccccgctgacattcgtcgtgaacaagtt
cgcctgcacagccgactgaccgaagtccagccactactttcccccagctga

DBGET integrated database retrieval system