KEGG   Salinispora arenicola: Sare_4961Help
Entry
Sare_4961         CDS       T00613                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
saq  Salinispora arenicola
Pathway
saq00071  Fatty acid degradation
saq00280  Valine, leucine and isoleucine degradation
saq00281  Geraniol degradation
saq00310  Lysine degradation
saq00360  Phenylalanine metabolism
saq00362  Benzoate degradation
saq00380  Tryptophan metabolism
saq00410  beta-Alanine metabolism
saq00627  Aminobenzoate degradation
saq00640  Propanoate metabolism
saq00650  Butanoate metabolism
saq00903  Limonene and pinene degradation
saq00930  Caprolactam degradation
saq01100  Metabolic pathways
saq01110  Biosynthesis of secondary metabolites
saq01120  Microbial metabolism in diverse environments
saq01130  Biosynthesis of antibiotics
saq01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:saq00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Sare_4961
   00650 Butanoate metabolism
    Sare_4961
  Lipid metabolism
   00071 Fatty acid degradation
    Sare_4961
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Sare_4961
   00310 Lysine degradation
    Sare_4961
   00360 Phenylalanine metabolism
    Sare_4961
   00380 Tryptophan metabolism
    Sare_4961
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Sare_4961
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Sare_4961
   00281 Geraniol degradation
    Sare_4961
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Sare_4961
   00627 Aminobenzoate degradation
    Sare_4961
   00930 Caprolactam degradation
    Sare_4961
Enzymes [BR:saq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Sare_4961
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ABW00708
JGI: Sare4961
UniProt: A8LWA3
Position
complement(5635352..5636113)
Genome map
AA seq 253 aa AA seqDB search
MGVRVERSGMVTTVILDRPEARNAVDGPTARALAEAIRAFEADPDAAVAVLWGAGGTFCA
GADLKAIGTPRGNRVAPDGDGPMGPTRMMPSKPVIAAISGYAVAGGLELALWCDLRVADD
DAVLGVFCRRWGVPLIDGGTFRLPRLIGESRAMDLILTGRPVPAAEAYAMGLVNRLVAPG
TARTAAEQLATEIARHPQTCLRNDRAAVLATAALPEPAALVTELAYGTESLATDALAGAA
RFTGGAGRHGAGA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtacgcgtcgagcggtccggaatggtcaccacggtgatcctggaccggccggag
gcgcgtaacgccgtggacggtccgaccgctcgggcgctggccgaggcgatccgcgccttc
gaggccgatccggacgcggcggtggcggtgctgtggggtgctggcggtacgttctgcgcc
ggggcggacctgaaagcgatcggtaccccccgcggcaaccgcgtcgcgcccgacggggac
ggaccgatgggcccgacccggatgatgccgtccaagccggtgatcgcggcgatctccggg
tacgcggtggcgggcgggctggagctggcgctctggtgtgacctgcgggtcgccgacgac
gatgcggtgcttggcgttttctgccggcgctggggggtaccgctgatcgacggtggaacg
ttccgcctgccccgactgatcggcgagagccgggcgatggacctgattctcaccggccgg
ccggtgccggctgccgaggcgtacgcgatgggcctggtgaaccggctggtcgcccctggt
acggcccgcacggccgccgagcagctggccacggagatcgccaggcacccgcagacctgc
ctgcgcaacgaccgggccgcggtgctggccacggcggcgctgccggagccggcggcgctg
gtgaccgagttggcgtacgggacggagtcgttggctaccgacgcgttggccggggctgcc
cggttcaccgggggagccggtcggcacggagccggggcctga

DBGET integrated database retrieval system