KEGG   Staphylococcus aureus subsp. aureus MRSA252 (MRSA): SAR0264Help
Entry
SAR0264           CDS       T00182                                 

Gene name
bglA
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sar  Staphylococcus aureus subsp. aureus MRSA252 (MRSA)
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:sar00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAR0264 (bglA)
Enzymes [BR:sar01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SAR0264 (bglA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
307688..309124
Genome map
AA seq 478 aa AA seqDB search
MTKLPQNFMWGGALAANQFEGGYDKGGKGLSVIDVMTSGAHGKARQITESIDPNHYYPNH
EGIDFYHRYKEDIALFKEMGLKCLRTSIAWTRIFPNGDEDVPNEEGLAFYDRIFDELIAQ
GIEPVVTLSHFEIPLHLAKHYGGFRNREVVNYFVHFARVVFERYKDKVTYWMTFNEINNQ
MDTSNPIFLWTNSGVALTENDNPEEVLYQVAHHELLASALAVRLGKEINPKFKIGTMISH
VPIYPYSCHPKDMMEAQIANRLRFFFPDVQVRGYYPSYAKKMLARKGYDFGWQEGDDSIL
QQGTVDYIGFSYYMSTAVKHDVDTTVENNIVNGGLNHSVENPHIATSDWGWAIDPDGLRY
TLNVLYDRYQLPLFIVENGFGAVDEVVDGHIHDDYRIEYLKAHITAAIEAVDQDGVDLIG
YTPWGIIDIVSFTTGEMKKRYGLIYVDRDNDGRGTMERLKKDSFYWYQQVIASNGDKL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaattaccgcaaaattttatgtggggtggcgctcttgccgccaatcaatttgaa
ggtggatatgataaaggtggtaaagggttaagtgtaattgatgttatgacgagtggtgca
catggtaaagcacgtcagattacagaatctatagatcccaatcactattatccaaatcat
gaaggtattgatttttatcatcgttataaggaagatattgccttgtttaaagaaatggga
ttgaaatgtttacgtacgtcgattgcttggacacgtatctttccgaatggggatgaagat
gtgccaaatgaagaaggacttgccttttatgatcgtatctttgatgaattaattgcacaa
ggtattgaacctgttgtgacgttatcacattttgagataccacttcatttagcgaaacat
tatggtggatttagaaatagagaagttgtcaattattttgtgcattttgcgcgtgttgta
tttgaaagatataaagataaagtgacatattggatgacgtttaatgaaataaataatcag
atggacacatcaaatcctatctttttatggacgaattctggggtagcattgacagaaaat
gataatcctgaagaagtcttgtatcaagtagcacatcatgaacttttagccagtgcttta
gcggttcgtcttggtaaagagattaatccgaaatttaagattggaacaatgatttcacat
gtacccatttatccatattcgtgtcatccgaaagatatgatggaagcacaaattgcgaat
cgcttacgtttctttttcccggatgttcaagtaagaggttattatccaagctatgctaaa
aaaatgttggcacgaaaaggatatgattttggatggcaagaaggggacgacagtatttta
cagcagggcacggttgattatattggctttagttattacatgtctacggctgtaaaacat
gatgttgatactacagttgaaaacaacatcgtcaacggtggtttgaatcattctgtggag
aatccgcatatcgcaacgagtgattggggttgggcgattgatccagatggcttaagatat
acattgaatgtgttatatgatcgttatcagttgccactttttattgtggaaaatggtttt
ggtgcagttgatgaagtggtagatggacatattcatgatgattatcgcattgaatattta
aaagcacatattacagcagcgatagaagcagttgatcaagatggtgtagatttaatcggt
tatacaccgtggggaatcattgatattgtttcatttacaactggtgaaatgaagaaacgc
tatggtttaatatatgttgatcgagataatgatggtcgtggcacgatggaacgcttgaaa
aaagattcgttctattggtatcaacaagtgatagcatcaaatggagataaattataa

DBGET integrated database retrieval system