KEGG   Staphylococcus aureus subsp. aureus MRSA252 (MRSA): SAR0394Help
Entry
SAR0394           CDS       T00182                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sar  Staphylococcus aureus subsp. aureus MRSA252 (MRSA)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sar00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAR0394
   01230 Biosynthesis of amino acids
    SAR0394
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAR0394
  Energy metabolism
   00680 Methane metabolism
    SAR0394
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAR0394
Enzymes [BR:sar01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SAR0394
Exosome [BR:sar04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SAR0394
  Exosomal proteins of melanoma cells
   SAR0394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Position
428909..429490
Genome map
AA seq 193 aa AA seqDB search
MTIYLVRHGESKSNYDNKHFRSYFCGQLDVPLTDTGTKSADDLCDYFKEKQIKHVYVSDL
LRTQQTFEHIFPYDIASTTTPLLRERSLGVFEGEYKDEISANPKYEKYFNDPNFKDFRHS
FSQKAPEGESYEDVYQRVEHFMNHVVNEDTQKDDIVIVAHQVVIRCLMVYFNKVSREEAV
DLKVENCKPYIIE
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgacgatttatttagttagacatggcgaatcaaaatcgaattatgataataaacatttt
agatcttatttttgtggacaattagatgtgccgttaacggatactggcacaaaaagtgcg
gacgatttatgtgattattttaaagagaaacagattaaacatgtatatgtttcagactta
ttaagaacacagcaaacgtttgaacatatttttccatatgacattgcatcaacgactacc
cctctattaagagaacgttcacttggcgtatttgagggtgaatataaagatgaaatcagt
gcgaatccgaaatatgaaaaatatttcaatgatccaaactttaaagactttcgacatagt
ttttcacaaaaagcgcctgaaggagaaagttatgaagatgtatatcaacgcgtagaacat
tttatgaatcatgttgtcaatgaagatacacaaaaagatgatatcgtcattgttgcacat
caagttgtcattcgttgtttgatggtttattttaacaaagtttcaagggaagaagctgtg
gatttaaaggtagaaaattgcaaaccatatatcattgaatag

DBGET integrated database retrieval system