KEGG   Staphylococcus aureus subsp. aureus MRSA252 (MRSA): SAR0517Help
Entry
SAR0517           CDS       T00182                                 

Gene name
folK
Definition
(GenBank) putative 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sar  Staphylococcus aureus subsp. aureus MRSA252 (MRSA)
Pathway
sar00790  Folate biosynthesis
sar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sar00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SAR0517 (folK)
Enzymes [BR:sar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     SAR0517 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK
Motif
Other DBs
NCBI-ProteinID: CAG39539
GeneDB: SAR0517
Structure
PDB: 

Jmol
Position
555945..556421
Genome map
AA seq 158 aa AA seqDB search
MIQAYLGLGSNIGDRESQLNDAIKILNEYDGINVSNISSIYETAPVGYTEQPNFLNLCVE
IQTTLTVLQLLECCLKTEECLHRVRKERWGPRTLDVDILLYGEEMIDLPNLSVPHPRMNE
RAFVLIPLNDIAANVIEPRSKLKVKDLVFVDDSVRRYK
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgattcaagcatacttaggattaggtagtaatattggtgatagagaaagccagttaaac
gatgctataaagattttgaatgaatatgatggtattaacgtatctaatatttcttcgatt
tatgaaacagcaccagttgggtatactgagcaacctaactttttaaatttgtgtgttgag
attcaaacaacactcacagtattacaactgttggaatgttgtttgaagacagaagaatgt
ttacaccgtgttagaaaggaacgatggggtcctagaactttagatgtggatattttgttg
tatggagaagaaatgatagatttaccaaatctgtcggtgccacatccgagaatgaatgaa
cgtgcatttgttttaatcccattaaatgatatagcagcaaatgtcatagaaccacgttcg
aaattgaaagtgaaagatttagtttttgtcgatgacagtgtaaggcgatataaataa

DBGET integrated database retrieval system