KEGG   Staphylococcus aureus subsp. aureus MRSA252 (MRSA): SAR0517Help
Entry
SAR0517           CDS       T00182                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sar  Staphylococcus aureus subsp. aureus MRSA252 (MRSA)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sar00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
555945..556421
Genome map
AA seq 158 aa AA seqDB search
MIQAYLGLGSNIGDRESQLNDAIKILNEYDGINVSNISSIYETAPVGYTEQPNFLNLCVE
IQTTLTVLQLLECCLKTEECLHRVRKERWGPRTLDVDILLYGEEMIDLPNLSVPHPRMNE
RAFVLIPLNDIAANVIEPRSKLKVKDLVFVDDSVRRYK
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgattcaagcatacttaggattaggtagtaatattggtgatagagaaagccagttaaac
gatgctataaagattttgaatgaatatgatggtattaacgtatctaatatttcttcgatt
tatgaaacagcaccagttgggtatactgagcaacctaactttttaaatttgtgtgttgag
attcaaacaacactcacagtattacaactgttggaatgttgtttgaagacagaagaatgt
ttacaccgtgttagaaaggaacgatggggtcctagaactttagatgtggatattttgttg
tatggagaagaaatgatagatttaccaaatctgtcggtgccacatccgagaatgaatgaa
cgtgcatttgttttaatcccattaaatgatatagcagcaaatgtcatagaaccacgttcg
aaattgaaagtgaaagatttagtttttgtcgatgacagtgtaaggcgatataaataa

DBGET integrated database retrieval system