KEGG   Staphylococcus aureus subsp. aureus MRSA252 (MRSA): SAR1339Help
Entry
SAR1339           CDS       T00182                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sar  Staphylococcus aureus subsp. aureus MRSA252 (MRSA)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sar00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SAR1339 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAR1339 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SAR1339 (thrC)
Enzymes [BR:sar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SAR1339 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1388925..1389986
Genome map
AA seq 353 aa AA seqDB search
MRRWQGLVEEFKAHLPVNENTPKLTLNEGNTPLIHCENMSEILGIDLYVKYEGANPTGSF
KDRGMVMAVTKAKEQGKKIVICASTGNTSASAAAYAARAGLKAIVVIPEGKIALGKLSQA
VMYGAEIVSIEGNFDEALEIVKEIAKSGEIELVNSVNPLRIEGQKTGSFEIVQQLDGEAP
DILAIPVGNAGNITAYWKGFKEYHEAKGSQLPKMFGFQAEGASPIVQNKVIKNPETIATA
IRIGNPASWDKATNALKESNGLIDSVTDDEILEAYQLMTTKEGVFSEPASNASIAGLIKL
HRQGKLPQGKKVVAILTGNGLKDPDTAISLLDNPIKPLPNDKDSIIDYIKGAL
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgagaagatggcaaggattagtagaagagtttaaagcacatttaccagtaaatgaaaat
acaccaaaattaactttgaatgagggaaatacaccactcattcattgtgaaaatatgtct
gaaatactaggtatagatttatatgtgaagtatgaaggtgccaatccgacaggttcattt
aaagatcgcggtatggtaatggctgtgacaaaagcaaaagagcaaggtaagaaaattgta
atatgcgcttcgactggaaatacatcagcgtctgcagcagcatatgcagcgagagcaggt
ttaaaagctatcgtcgtaataccagaaggtaaaattgcattaggtaaattgtcgcaagca
gtaatgtatggtgcagaaatcgtttctattgaaggaaactttgatgaagctttagaaatt
gtaaaagaaattgcaaaaagtggcgaaatcgagcttgtaaactctgtcaatccacttaga
atcgaagggcaaaagacaggctcatttgaaattgtacaacaattagacggtgaagcacct
gatattttagcgattcctgtaggtaatgcaggtaatattactgcatattggaaaggcttt
aaagaatatcatgaagctaaaggatcacaattgccgaaaatgtttggcttccaagctgaa
ggtgcatcaccaattgttcaaaataaagtcattaaaaatcctgaaacgattgcaactgct
attcgaattggtaatcctgctagttgggataaagcgactaatgctcttaaagaatcaaat
ggattaatagatagtgttactgatgatgaaattttagaagcatatcagttaatgacaact
aaagaaggtgtctttagtgaaccagcaagtaatgcttctattgcaggtttaattaaattg
cacagacaaggtaaattacctcaaggtaaaaaagtagttgcgattttaactggtaatggg
ttaaaagatccagatactgctatttcactattagataatccgataaagccattgccaaat
gataaagatagcattatcgattatattaaaggagctttataa

DBGET integrated database retrieval system