KEGG   Staphylococcus aureus subsp. aureus MRSA252 (MRSA): SAR1383Help
Entry
SAR1383           CDS       T00182                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase (EC:4.1.1.48)
  KO
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sar  Staphylococcus aureus subsp. aureus MRSA252 (MRSA)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sar00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SAR1383 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SAR1383 (trpC)
Enzymes [BR:sar01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SAR1383 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
GeneDB: 
UniProt: 
Position
1440886..1441668
Genome map
AA seq 260 aa AA seqDB search
MTILEEIVEYKQLLLQNGYYQDKLNTLKSVNIQNKKSFINAIEKEPKLAIIAEIKSKSPT
VNDLPERDLSQQISDYEQYGANAVSILTDEKYFGGSFERLQALTTKTTLPVLCKDFIIDP
LQIDVAKQAGASMILLIVNILSDKQLKDLYNYAISQNLEVLVEVHDRHELERAYKVNAKL
IGVNNRDLKRFVTNVEHTNTILENKKPNHYYISESGIHDVSDVRKILHSGIDGLLIGEAL
MRCDNLSEFLPQLKMQKVKS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacaattttagaagaaattgttgaatataaacagttacttttacaaaatggctattat
caagacaaacttaataccttgaaaagtgtgaacattcagaataaaaaatcttttataaat
gcaattgagaaagaaccaaagctagcaattattgcagaaattaaatcgaagagtcctaca
gttaatgacttacctgaacgagatttatcgcaacaaatctcagattatgagcaatatggt
gcaaatgctgtatccattttgactgatgaaaagtactttggtggtagttttgaaagatta
caagcattgacaacaaaaacaacattacccgtattatgcaaagattttattatagatccg
cttcaaattgatgttgccaaacaagctggtgcatctatgattttactgattgttaatatc
ttatcggataaacaattgaaagatttatataactacgctatatcgcaaaatttagaagtg
ttagttgaagtacatgatcgtcatgaattagaacgtgcctataaggttaatgctaaattg
attggtgtaaataacagggacttaaaacgatttgtcacaaatgtggaacatacaaatact
attttagaaaataaaaaaccaaatcattattatatttctgaaagtggaattcacgatgta
tctgatgtaagaaaaatcttgcatagtggtatcgatggcttactaataggtgaggcgctt
atgcgttgtgacaatctatctgaatttttaccacaactgaaaatgcaaaaggtgaagtca
tga

DBGET integrated database retrieval system