KEGG   Staphylococcus aureus subsp. aureus MRSA252 (MRSA): SAR1383Help
Entry
SAR1383           CDS       T00182                                 

Gene name
trpC
Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sar  Staphylococcus aureus subsp. aureus MRSA252 (MRSA)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sar01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:sar00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1440886..1441668
Genome map
AA seq 260 aa AA seqDB search
MTILEEIVEYKQLLLQNGYYQDKLNTLKSVNIQNKKSFINAIEKEPKLAIIAEIKSKSPT
VNDLPERDLSQQISDYEQYGANAVSILTDEKYFGGSFERLQALTTKTTLPVLCKDFIIDP
LQIDVAKQAGASMILLIVNILSDKQLKDLYNYAISQNLEVLVEVHDRHELERAYKVNAKL
IGVNNRDLKRFVTNVEHTNTILENKKPNHYYISESGIHDVSDVRKILHSGIDGLLIGEAL
MRCDNLSEFLPQLKMQKVKS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacaattttagaagaaattgttgaatataaacagttacttttacaaaatggctattat
caagacaaacttaataccttgaaaagtgtgaacattcagaataaaaaatcttttataaat
gcaattgagaaagaaccaaagctagcaattattgcagaaattaaatcgaagagtcctaca
gttaatgacttacctgaacgagatttatcgcaacaaatctcagattatgagcaatatggt
gcaaatgctgtatccattttgactgatgaaaagtactttggtggtagttttgaaagatta
caagcattgacaacaaaaacaacattacccgtattatgcaaagattttattatagatccg
cttcaaattgatgttgccaaacaagctggtgcatctatgattttactgattgttaatatc
ttatcggataaacaattgaaagatttatataactacgctatatcgcaaaatttagaagtg
ttagttgaagtacatgatcgtcatgaattagaacgtgcctataaggttaatgctaaattg
attggtgtaaataacagggacttaaaacgatttgtcacaaatgtggaacatacaaatact
attttagaaaataaaaaaccaaatcattattatatttctgaaagtggaattcacgatgta
tctgatgtaagaaaaatcttgcatagtggtatcgatggcttactaataggtgaggcgctt
atgcgttgtgacaatctatctgaatttttaccacaactgaaaatgcaaaaggtgaagtca
tga

DBGET integrated database retrieval system