KEGG   Staphylococcus aureus subsp. aureus MRSA252 (MRSA): SAR1385Help
Entry
SAR1385           CDS       T00182                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sar  Staphylococcus aureus subsp. aureus MRSA252 (MRSA)
Pathway
sar00260  Glycine, serine and threonine metabolism
sar00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sar01100  Metabolic pathways
sar01110  Biosynthesis of secondary metabolites
sar01130  Biosynthesis of antibiotics
sar01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sar00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAR1385 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SAR1385 (trpB)
Enzymes [BR:sar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SAR1385 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CAG40383
GeneDB: SAR1385
UniProt: Q6GH33
Position
1442293..1443507
Genome map
AA seq 404 aa AA seqDB search
MNKQIQTEADELGFFGEYGGQYVPETLMPAIIELKKAYKEAKADPEFQRELEYYLSEYVG
RATPLTYAASYTESLGGAKIYLKREDLNHTGAHKINNALGQALLAKRMGKKKLVAETGAG
QHGVASATVAALFDMELVVFMGSEDIKRQQLNVFRMELLGAKVVAVEDGQGTLSDAVNKA
LQYWVSHVDDTHYLLGSALGPDPFPTIVRDFQSVIGKEIKSQILKKEGRLPDAIVACIGG
GSNAIGTFYPFIKDDVALYGVEAAGQGEDTDKHALAIGKGSPGVLHGTKMYLIQDEGGQV
QLAHSISAGLDYPGIGPEHSYYHDIGRVTFENASDTQAMNALINFTKHEGIIPAIESAHA
LSYVERLAPTMSKEDIIVVTISGRGDKDMETIRQYMAERGLAND
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacaaatacaaacagaagcagatgaattaggtttctttggtgaatacggaggg
caatatgttccagaaacattaatgccagcaattattgagttgaaaaaagcttataaagag
gcaaaagcagacccagagtttcaaagagaacttgaatactatttatcagagtatgtagga
cgcgcgacgccacttacatatgctgcatcgtatactgaaagcttaggtggcgctaagata
tatttaaaacgagaggatctaaatcatacaggcgcccataaaattaataatgcgttaggt
caagcgttgctcgctaaaagaatgggcaagaagaagcttgttgctgaaacaggtgcgggt
caacatggtgtagctagtgctacggttgctgcattatttgatatggaacttgttgtcttt
atgggaagtgaagatattaaaagacaacaacttaatgtatttagaatggaattacttggt
gcaaaggttgtggcagttgaagatggtcaagggactttatcggatgcagttaataaagca
ttgcaatattgggtaagtcatgtagatgatacgcattatttattaggttctgcattgggt
ccagacccattcccaacgattgttagagattttcagagtgtgattggtaaagaaataaaa
tcacagatattgaagaaagaaggtcgacttccggatgcaattgtagcatgtatcggtggt
ggctcaaatgcaatcggtacattttatccatttattaaagatgatgttgctttatacggt
gttgaagccgcaggtcaaggcgaggatactgataaacatgcacttgcaattggcaaagga
tcacctggcgtattacatggtactaaaatgtatttaattcaagatgaaggtgggcaagtg
caactagcacattctatttcagcaggacttgattatcctggtattgggccagaacattct
tattaccacgacattggtagagtaacttttgaaaatgcaagtgatacacaagcaatgaat
gctttaatcaactttacaaaacatgaaggtattatacctgcaattgaaagtgcacatgca
ctgagttatgttgaaagactagcgcctacgatgtcgaaagaagatattattgtagtaaca
atttctggacgtggcgataaagatatggaaacaattagacaatatatggcagagcgaggt
cttgcaaatgactaa

DBGET integrated database retrieval system