KEGG   Staphylococcus aureus subsp. aureus MRSA252 (MRSA): SAR1386Help
Entry
SAR1386           CDS       T00182                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sar  Staphylococcus aureus subsp. aureus MRSA252 (MRSA)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sar00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SAR1386 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAR1386 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SAR1386 (trpA)
Enzymes [BR:sar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SAR1386 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1443500..1444228
Genome map
AA seq 242 aa AA seqDB search
MTKLFIPYIMGNKDLIENATLLSENGADIIEIGVPFSDPVADGPVIMEAGQQAIKQGITI
DYIFEQLEKHGNQIKCQYVLMTYYNIICHYGEQAFFEKCRDTGVYGLIIPDLPFELSQRL
KQQFSHYGVKIISLVAMTTDDKRIKDIVSYAEGFIYTVTMNATTGQNGAFHPELKRKIES
IKAIANVPVVAGFGIRSPQHVADIKEVADGIVIGSEIVKRFKSNTREEIIKYLQSIQQTL
NN
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgactaaattatttataccttatattatgggcaataaagatttgattgaaaatgcaaca
ttgttgagtgaaaatggtgcagatataattgaaattggtgtacctttctctgatccggtt
gctgatggtccagttatcatggaagcaggtcaacaagcgattaaacaaggcataacgata
gattatattttcgagcaattagaaaaacacggtaatcaaattaagtgtcagtatgtatta
atgacgtattataatataatttgtcattatggagaacaagcgttttttgaaaaatgtcga
gataccggtgtctacggcttaattattcctgatttaccatttgaattatcgcagcgttta
aaacaacaatttagtcactatggtgtcaaaatcatatcgttagttgcgatgactactgat
gacaaacgtataaaagatatcgtatcatatgcggaaggctttatttatactgtgacaatg
aatgcgacgacaggacaaaacggtgcgtttcacccagaattaaaacgaaaaattgagtca
attaaagcgatagccaatgtgccagttgtcgcaggatttggtataagatctccacaacat
gttgcagatataaaagaggttgcagatggtatcgttattggtagtgaaatagtaaaacga
tttaaatctaacacgcgtgaagaaatcattaaatatttacaatctatccagcaaacattg
aataattaa

DBGET integrated database retrieval system