KEGG   Staphylococcus aureus subsp. aureus MRSA252 (MRSA): SAR1624Help
Entry
SAR1624           CDS       T00182                                 

Gene name
glkA
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sar  Staphylococcus aureus subsp. aureus MRSA252 (MRSA)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sar00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAR1624 (glkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAR1624 (glkA)
   00052 Galactose metabolism
    SAR1624 (glkA)
   00500 Starch and sucrose metabolism
    SAR1624 (glkA)
   00520 Amino sugar and nucleotide sugar metabolism
    SAR1624 (glkA)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SAR1624 (glkA)
   00524 Butirosin and neomycin biosynthesis
    SAR1624 (glkA)
Enzymes [BR:sar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SAR1624 (glkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(1692942..1693928)
Genome map
AA seq 328 aa AA seqDB search
MTKIILAADVGGTTCKLGIFTPELEQLHKWSIHTDTSDSTGYTLLKGIYDSFVEKVNENN
YNFSNVLGVGIGVPGPVDFEKGTVNGAVNLYWPEKVNVREIFEQFVDCPVYVDNDANIAA
LGEKHKGAGEGADDVVAITLGTGLGGGIISNGEIVHGHNGSGAEIGHFRADFDQRFKCNC
GRSGCIETVASATGVVNLVNFYYPKLTFRSSILELIKENKVTAKAVFDAAKAGDQFCIFI
TEKVANYIGYLCSIISVTSNPKYIVLGGGMSTAGPILIENIKTEYHNLTFAPAQFETEIV
QAKLGNDAGITGAAGLIKTYVLDKEGVK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaattattttagcagctgatgtaggcgggacgacttgtaaattaggtattttc
acacctgaattagaacaattacataaatggtctattcacactgatacatctgatagtaca
ggttatacacttttgaaaggaatttatgattcgtttgttgaaaaagtaaatgaaaataat
tataatttttcaaatgtacttggcgtaggtattggtgttccaggtcctgttgactttgaa
aaaggtacagtaaatggagcagtaaacttatattggccagaaaaagttaatgtacgtgag
atttttgaacaattcgttgattgtccagtgtatgtagataatgatgctaacatagctgct
ttaggggagaaacacaaaggtgctggtgaaggtgccgatgatgttgttgccatcacactt
ggtacaggactaggtggaggaattatttcaaatggtgaaatcgtacatggtcataatggc
tctggcgcagaaataggtcattttagagcagacttcgatcaacgatttaaatgtaattgt
ggtcgttctggatgtattgaaacagttgcttcagcgacaggcgttgttaacttagtcaac
ttctactatccgaagttgacgtttagatcttctatattagaattgattaaagaaaataag
gttacagcaaaagctgtttttgatgcggctaaagctggtgaccaattctgtattttcata
actgaaaaggttgcaaactatattggatatttatgtagtattattagtgttacaagtaat
ccgaaatatatcgttctaggtggaggaatgtctactgcaggacctattttaattgaaaat
attaaaacagaatatcataatttaacatttgcacctgctcaatttgaaactgaaattgta
caagcgaaattaggtaatgatgcaggtattacaggagcagcaggattaatcaagacctat
gtattagataaagagggggtaaaataa

DBGET integrated database retrieval system