KEGG   Staphylococcus aureus subsp. aureus MRSA252 (MRSA): SAR1811Help
Entry
SAR1811           CDS       T00182                                 

Gene name
acsA
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sar  Staphylococcus aureus subsp. aureus MRSA252 (MRSA)
Pathway
sar00010  Glycolysis / Gluconeogenesis
sar00620  Pyruvate metabolism
sar00640  Propanoate metabolism
sar00680  Methane metabolism
sar01100  Metabolic pathways
sar01110  Biosynthesis of secondary metabolites
sar01120  Microbial metabolism in diverse environments
sar01130  Biosynthesis of antibiotics
sar01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sar00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAR1811 (acsA)
   00620 Pyruvate metabolism
    SAR1811 (acsA)
   00640 Propanoate metabolism
    SAR1811 (acsA)
  Energy metabolism
   00680 Methane metabolism
    SAR1811 (acsA)
Enzymes [BR:sar01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SAR1811 (acsA)
Lipid biosynthesis proteins [BR:sar01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SAR1811 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: CAG40802
GeneDB: SAR1811
Position
complement(1889504..1891210)
Genome map
AA seq 568 aa AA seqDB search
MKVEVYKGAQGKHNLKDYEETYNTFDWKDVEQAFSWSETGKMNMAYECIDRHVDQGLGDK
IALNYKDEHRKESYTYKDMQRLSNKAANVLSEHAEVDKGDRVFIFMSRTPELYFALLGVL
KIGAIVGPLFEAFMEKAVADRLENSEAKVLITNKALLPRVPVDKLPNLKKIVVVDEDVED
NYIDFISLMETASDEFDIEWLKSDDGLILHYTSGSTGQPKGVLHVQQAMLVHYISGKYVL
DLQEDDVYWCTADPGWVTGTSYGIFAPWLNGATNCIAGGRFSPEQWYSMIEDFKVTIWYT
APTALRMLMSAGDDIVEKYDLSSLRSILSVGEPLNPEVIKWAKKVYGLTVLDTWWMTETG
GHMIVNYPTMDVKLGSMGKPLPGIQAAIIDDAGNELPPNRMGNLAIKKGWPSMMYRIWKN
PEKYKSYFIGDWYVSGDSAYKDEDGYFWFQGRVDDVIMTAGERVGPFEVESKLVEHEAVA
EAGIIGKPDPVRGEIIKAFVALRKGYEPTDELKEEIRLFVKEGLSAHAAPREIEFKDKLP
KTRSGKIMRRVLKAWELNLDAGDLSTME
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcgaagtttataaaggagcgcaaggcaaacataaccttaaagattatgaagaa
acatataatacttttgattggaaagacgtagaacaagcattttcttggagtgaaactgga
aaaatgaacatggcatatgaatgtatagatcgccatgtagatcaaggattaggggataaa
atagcattaaattacaaagatgaacacagaaaagaatcgtatacttataaagatatgcaa
cggttatctaataaagcggcgaatgttttgtctgaacatgcagaagttgacaaaggtgac
agagtatttatatttatgtcgcgtacacctgaactatattttgcgttgttaggtgtttta
aaaattggtgcaattgttgggccgttatttgaagcatttatggaaaaggcggttgcggat
agattagagaacagtgaagctaaagtgttaattactaataaggcattgttacctcgagta
cctgtagataaattaccgaacttgaaaaaaattgttgtcgtagatgaggatgtagaagac
aattacatagacttcattagtttgatggaaactgctagcgatgaatttgacattgaatgg
ttaaagtcggatgatggtttgattttacattatacatcaggttctactgggcaacctaaa
ggtgtattgcatgttcaacaagcgatgttagtgcactatatttctggaaaatatgtatta
gatttacaagaagatgatgtttattggtgtacagcagatccaggttgggttacaggaaca
tcttatggtatttttgcaccatggttaaatggcgctacaaattgtatagctggtggtcgc
ttttcaccagaacaatggtatagtatgattgaagattttaaagtgacgatttggtatacg
gcaccaacagctttaagaatgttaatgagtgctggtgacgatattgttgagaaatatgac
ttgtcatcgttacgttcgattctatcagtaggtgagcctttaaatcctgaagttataaaa
tgggcgaaaaaagtatacggtttaacggtgttagatacttggtggatgacagaaacaggt
ggacatatgattgttaactatccaacgatggacgtcaagcttggctcaatgggcaaacca
ttacctggtattcaagctgcaattatcgatgatgcaggtaatgaattaccaccaaatcga
atgggcaaccttgctataaaaaaaggctggccatcaatgatgtatcgtatctggaagaat
ccagaaaaatataagtcatattttattggagactggtatgtatctggtgattcggcatat
aaagatgaagatggttacttttggttccaaggacgtgttgatgatgtaattatgacagct
ggcgaacgagttgggccatttgaggttgagtctaaattggttgaacacgaagcagttgcc
gaagcaggaattattggtaaacctgatccggttcgcggtgaaataattaaggcgtttgtt
gcactgagaaaaggatatgaaccaacagacgaattaaaagaagaaattcgtttatttgtt
aaagaaggtttgtcggcgcatgcagcaccacgtgaaatcgaatttaaagataaattacct
aaaacacgctcaggtaaaattatgagacgtgtattaaaagcttgggaattaaatttagat
gcaggggatttaagtacaatggaataa

DBGET integrated database retrieval system