KEGG   Staphylococcus aureus subsp. aureus MRSA252 (MRSA): SAR2109Help
Entry
SAR2109           CDS       T00182                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sar  Staphylococcus aureus subsp. aureus MRSA252 (MRSA)
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sar00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SAR2109
  Amino acid metabolism
   00300 Lysine biosynthesis
    SAR2109
Enzymes [BR:sar01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SAR2109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2172100..2173323
Genome map
AA seq 407 aa AA seqDB search
MTTFSEKEKIQLLADIVELQTENNNEIDVCNYLKDLFDKYDIKSEILKVNEHRANFVAEI
GSGSPILALSGHMDVVDAGNQDNWTYPPFQLTEKDDKLYGRGTTDMKGGLMALVIALIEL
KEQNQLPQGTIRLLATAGEEKEQEGAKLLADKGYLDDVDGLMIAEPTGSGIYYAHKGSMS
CKVTATGKAVHSSVPFIGDNAIDTLLEFYNQFKEKYAELKKNDTKHELDVAPMFKSLIGK
DISEEDANYASGLTAVCSIINGGKQFNSVPDEASLEFNVRPVPEYDNDFIESFFQNIINN
VDSNKLSLDIPSNHRPVTSDKNSKLITTIKDVASSYVDKDDIFVSALVGATDASSFLGDN
KDNVDLAIFGPGNPLMAHQIDEYIEKDMYLKYIDIFKEASIQYLKEK
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgacaacttttagtgaaaaagaaaaaattcaattactagcagatattgttgaactacaa
actgaaaataataatgaaatagacgtttgtaattatttaaaagatttattcgacaagtac
gatattaaatctgaaattttgaaagttaatgaacaccgcgccaatttcgttgcagaaatc
ggtagtggctctcccatacttgcattgagcggtcatatggatgttgttgatgcaggaaat
caagataattggacttatcccccttttcaactcacagaaaaagatgacaaattatatggt
cgaggcacaacagatatgaaaggcggtctgatggctttggtcatcgcactcattgaatta
aaagaacaaaaccaattacctcaaggaaccattagattactcgctactgctggtgaagag
aaagaacaagaaggcgccaaattattagcagataaaggctatttagatgatgttgatggt
ctaatgattgctgaaccaactggatctggaatttattatgcacataaagggtctatgtca
tgtaaagtaactgcaactggtaaagctgtccatagctcagttccatttattggtgacaat
gcaattgatacactgcttgaattttataatcaatttaaagaaaaatatgcagagcttaaa
aaaaatgatactaaacatgagttagatgttgctcccatgttcaaatcattgataggaaaa
gatatttctgaagaggatgcaaattatgcatctggtcttacagctgtatgttcgattata
aatggcggtaaacaatttaactctgtaccagatgaagcttcacttgaatttaacgtaaga
ccagttcctgagtatgataacgactttatagaatcgtttttccaaaatatcattaataat
gtggatagcaataagctttcactcgatattccaagcaaccatcgacctgtaacaagcgat
aaaaatagcaaattaattactacgattaaagatgtagcttctagttatgtagacaaagac
gatatatttgtttcggcgcttgtaggtgcaacggatgcttccagcttcttaggagataat
aaggacaatgttgatttagccatttttggaccaggtaatccattaatggcacatcaaatc
gatgaatatattgaaaaagatatgtatctgaaatatattgatattttcaaagaggcttcc
attcaatatttaaaggagaaataa

DBGET integrated database retrieval system