KEGG   Staphylococcus aureus subsp. aureus MRSA252 (MRSA): SAR2188Help
Entry
SAR2188           CDS       T00182                                 

Gene name
murA1
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
sar  Staphylococcus aureus subsp. aureus MRSA252 (MRSA)
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sar00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:sar00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(2257046..2258311)
Genome map
AA seq 421 aa AA seqDB search
MDKIVIKGGNKLTGEVKVEGAKNAVLPILTASLLASDKPSKLVNVPALSDVETINNVLTT
LNADVTYKKDENAVVVDATKTLNEEAPYEYVSKMRASILVMGPLLARLGHAIVALPGGCA
IGSRPIEQHIKGFEALGAEIHLENGNIYANAKDGLKGTSIHLDFPSVGATQNIIMAASLA
KGKTLIENAAKEPEIVDLANYINEMGGRITGAGTDTITINGVESLHGVEHAIIPDRIEAG
TLLIAGAITRGDIFVRGAIKEHMASLVYKLEEMGVELEYQEDGIRVRAEGDLQPVDIKTL
PHPGFPTDMQSQMMALLLTANGHKVVTETVFENRFMHVAEFKRMNANINVEGRSAKLEGK
SQLQGAQVKATDLRAAAALILAGLVADGKTSVTELTHLDRGYVDLHGKLKQLGADIERIN
D
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggataaaatagtaatcaaaggtggaaataaattaacgggtgaagttaaagtagaaggt
gctaaaaatgcagtattacctatattaacagcatctttattagcttctgataaaccgagc
aaattagttaatgttccagctttaagtgatgtagaaacaataaataatgtattaacaacc
ttaaatgctgacgttacatacaaaaaggacgaaaatgctgttgtcgttgatgcaacaaag
actctaaatgaagaggcaccatatgaatatgttagtaaaatgcgtgcaagtattttagtt
atgggacctcttttagcaagactaggacatgctattgttgcattgcctggtggttgtgca
attggaagtagaccgattgagcaacacattaaaggttttgaagctttaggcgcagaaatt
catcttgaaaatggtaatatttatgctaatgctaaagatggattaaaaggtacatcaatt
catttagattttccaagtgtaggagcaacacaaaatattattatggcagcatcattagct
aagggtaagactttaattgaaaatgcagctaaagaacctgaaattgttgatttagcaaac
tacattaatgaaatgggcggtagaattactggtgctggtacagacacaattacaatcaat
ggtgtagaatcattacatggtgtagaacatgctatcattccagatagaattgaagcaggc
acattactgatcgctggtgccattactcgtggcgatatttttgtacgtggtgcaatcaaa
gaacatatggctagtttagtgtataaattagaagaaatgggcgttgaattggaatatcaa
gaagatggtattcgtgtacgtgctgaaggagatttacagcctgttgacatcaaaacatta
ccgcatcctggttttccaaccgatatgcagtcacaaatgatggcattattattaacagca
aacggacataaagtagtaactgaaactgtatttgaaaatcgttttatgcatgtcgcagag
ttcaaacgtatgaatgctaatatcaatgtagaaggtcgtagtgctaaacttgaaggtaaa
agtcaattgcaaggtgcacaagttaaagcgactgatttaagagcagcagcagccttaatt
ttagctggattagttgctgatggtaaaacaagcgttactgaattaacgcacctagataga
ggctatgttgacttacacggtaaattgaagcaattaggtgcagacattgaacgtattaac
gattaa

DBGET integrated database retrieval system