KEGG   Staphylococcus aureus subsp. aureus MRSA252 (MRSA): SAR2202Help
Entry
SAR2202           CDS       T00182                                 

Definition
hypothetical protein
Organism
sar  Staphylococcus aureus subsp. aureus MRSA252 (MRSA)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(2269674..2270198)
Genome map
AA seq 174 aa AA seqDB search
MKDLTMLLHELKDMSFFNKGDICLIGCSTSEVIGEKIGTVGSMEVAETIFNALDVVSKET
GVTFAFQGCEHINRAITIEKSQFNPLTMEEVSVVPDVHAGGSLATYAFQHMKDPIVVEHI
TVPCGIDIGQTLIGMHIKHVCVPVRTSVKQVGQAIVTIATSRPKKIGGERAKYQ
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatttgacaatgttattacacgaattaaaagatatgtccttttttaataaagga
gatatatgtttaattggatgttcaacatcggaagtcattggcgaaaaaatagggactgtc
ggttcgatggaagttgcagaaactatttttaatgcattagatgttgtgagtaaagagaca
ggcgttacttttgcttttcaaggatgtgaacatatcaacagagcgataacaatagaaaaa
tctcagtttaatccattaacaatggaagaagtttccgtcgttccagatgtacatgctgga
gggagtttggcaacatacgcttttcagcatatgaaggatccaatcgtggtcgaacatatt
actgttccttgtggaattgatattggtcaaacgttaataggcatgcatattaaacatgta
tgtgtacctgtaaggacttcagtaaagcaagtaggacaggcaattgtaactattgccaca
tctaggccgaaaaagattggtggcgaacgtgctaaataccaataa

DBGET integrated database retrieval system