KEGG   Staphylococcus aureus subsp. aureus MRSA252 (MRSA): SAR2255Help
Entry
SAR2255           CDS       T00182                                 

Gene name
rocF
Definition
(RefSeq) arginase (EC:3.5.3.1)
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
sar  Staphylococcus aureus subsp. aureus MRSA252 (MRSA)
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sar00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SAR2255 (rocF)
  Amino acid metabolism
   00220 Arginine biosynthesis
    SAR2255 (rocF)
   00330 Arginine and proline metabolism
    SAR2255 (rocF)
Enzymes [BR:sar01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     SAR2255 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(2330622..2331530)
Genome map
AA seq 302 aa AA seqDB search
MTKKKGIDIIGVPSTFGQRKLGVDLGPTAIRYAGLIPRLKQLDLDVNDKGDIKVSAVDIE
KFQSEQNGLRNYDEIIDVTQKLNKEVSASIENNRFPLVLGGDHSIAIGSVSAISKHYNNL
GVIWYDAHGDLNIPEESPSGNIHGMPLRILTGEGPKELLELNSNVIKPENIVLIGMRDLD
KGERQFIKDHNIKTFTMSDIDKLGIKEVIENTIEYLKSRNVDGVHLSLDVDALDPLETPG
TGTRVLGGLTYRESHFALELLHQSQSVTSMDLVEVNPLIDHNNHTAEQSVSLVGTFFGET
LL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagaaaaaaggaattgatattattggtgtaccgtcaacatttggacaaagaaaa
ttaggtgttgatttaggaccaactgcgattagatatgcaggtttaataccaagactaaag
caattagaccttgatgttaatgacaaaggggatattaaggtatcagctgtagacattgaa
aaatttcaaagtgaacaaaatggattaagaaactacgatgaaattatagatgttactcaa
aaattaaataaagaagtatcagcatcaattgaaaataacagatttcctctagttcttggt
ggagatcattctattgcgataggttcagtatcagcaataagtaaacattataataattta
ggtgttatttggtatgatgcacatggtgatttaaatatacctgaagagtcaccaagtgga
aatattcatggtatgcctctaaggattttgacaggtgaaggtcctaaagaacttttagaa
ttaaatagtaatgtaatcaagccagaaaacatcgtactaattggtatgagagatttagat
aaaggtgaaagacaatttatcaaagatcataatattaaaacatttactatgtcagatatt
gataaattggggataaaggaagtaattgaaaatacaatagaatatttgaagtcacgcaat
gttgatggcgttcatttatctttagatgttgatgccttagatccacttgaaacgccaggc
acaggtactagagtcttaggcggacttacatatagagaaagtcattttgcgctggaatta
ttacatcagtctcagtcagttacttcaatggacttagttgaagtgaatccacttattgat
cataataaccatactgctgaacaatcggtttcgttagttggaacattttttggtgaaact
ttattataa

DBGET integrated database retrieval system