KEGG   Staphylococcus aureus subsp. aureus MRSA252 (MRSA): SAR2255Help
Entry
SAR2255           CDS       T00182                                 

Gene name
rocF
Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
sar  Staphylococcus aureus subsp. aureus MRSA252 (MRSA)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sar00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SAR2255 (rocF)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SAR2255 (rocF)
Enzymes [BR:sar01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     SAR2255 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(2330622..2331530)
Genome map
AA seq 302 aa AA seqDB search
MTKKKGIDIIGVPSTFGQRKLGVDLGPTAIRYAGLIPRLKQLDLDVNDKGDIKVSAVDIE
KFQSEQNGLRNYDEIIDVTQKLNKEVSASIENNRFPLVLGGDHSIAIGSVSAISKHYNNL
GVIWYDAHGDLNIPEESPSGNIHGMPLRILTGEGPKELLELNSNVIKPENIVLIGMRDLD
KGERQFIKDHNIKTFTMSDIDKLGIKEVIENTIEYLKSRNVDGVHLSLDVDALDPLETPG
TGTRVLGGLTYRESHFALELLHQSQSVTSMDLVEVNPLIDHNNHTAEQSVSLVGTFFGET
LL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagaaaaaaggaattgatattattggtgtaccgtcaacatttggacaaagaaaa
ttaggtgttgatttaggaccaactgcgattagatatgcaggtttaataccaagactaaag
caattagaccttgatgttaatgacaaaggggatattaaggtatcagctgtagacattgaa
aaatttcaaagtgaacaaaatggattaagaaactacgatgaaattatagatgttactcaa
aaattaaataaagaagtatcagcatcaattgaaaataacagatttcctctagttcttggt
ggagatcattctattgcgataggttcagtatcagcaataagtaaacattataataattta
ggtgttatttggtatgatgcacatggtgatttaaatatacctgaagagtcaccaagtgga
aatattcatggtatgcctctaaggattttgacaggtgaaggtcctaaagaacttttagaa
ttaaatagtaatgtaatcaagccagaaaacatcgtactaattggtatgagagatttagat
aaaggtgaaagacaatttatcaaagatcataatattaaaacatttactatgtcagatatt
gataaattggggataaaggaagtaattgaaaatacaatagaatatttgaagtcacgcaat
gttgatggcgttcatttatctttagatgttgatgccttagatccacttgaaacgccaggc
acaggtactagagtcttaggcggacttacatatagagaaagtcattttgcgctggaatta
ttacatcagtctcagtcagttacttcaatggacttagttgaagtgaatccacttattgat
cataataaccatactgctgaacaatcggtttcgttagttggaacattttttggtgaaact
ttattataa

DBGET integrated database retrieval system