KEGG   Staphylococcus aureus subsp. aureus MRSA252 (MRSA): SAR2506Help
Entry
SAR2506           CDS       T00182                                 

Definition
(GenBank) putative phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sar  Staphylococcus aureus subsp. aureus MRSA252 (MRSA)
Pathway
sar00010  Glycolysis / Gluconeogenesis
sar00260  Glycine, serine and threonine metabolism
sar00680  Methane metabolism
sar01100  Metabolic pathways
sar01110  Biosynthesis of secondary metabolites
sar01120  Microbial metabolism in diverse environments
sar01130  Biosynthesis of antibiotics
sar01200  Carbon metabolism
sar01230  Biosynthesis of amino acids
Module
sar_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sar_M00002  Glycolysis, core module involving three-carbon compounds
sar_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sar00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAR2506
  Energy metabolism
   00680 Methane metabolism
    SAR2506
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAR2506
Enzymes [BR:sar01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SAR2506
Membrane trafficking [BR:sar04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SAR2506
Exosome [BR:sar04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SAR2506
  Exosomal proteins of melanoma cells
   SAR2506
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CAG41486
GeneDB: SAR2506
UniProt: Q6GE17
Position
complement(2578730..2579416)
Genome map
AA seq 228 aa AA seqDB search
MPKLILCRHGQSEWNAKNLFTGWEDVNLSEQGINEATRAGEKVRENNIDIDVAFTSLLTR
ALDTTHYILTESKQQWIPVYKSWRLNERHYGGLQGLNKDDARKEFGEEQVHIWRRSYDVK
PPAETEEQREAYLADRRYNHLDKRMMPYSESLKDTLVRVIPFWTDHISQYLLDGQTVLVS
AHGNSIRALIKYLEDVSDEDIINYEIKTGAPLVYELTDDLEVIDKYYL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattaattttatgtcgtcatggacaaagcgagtggaatgctaaaaacttattt
actggatgggaagatgttaatttatctgaacaaggtattaatgaagcgactagagcaggt
gaaaaagtaagagaaaataacattgacatcgatgtagcttttacatcgttattaacacgt
gctttagatacaacgcattatattttaactgaatctaaacaacaatggattcctgtatat
aaaagctggcgtttaaatgagcgtcactatggtggattgcaaggcttaaataaagatgat
gctagaaaagaatttggagaggaacaagtacatatttggcgtcgttcttatgatgtgaaa
ccacctgctgaaaccgaagaacaacgtgaagcttacttagctgatcgtcgatataatcat
ttagataaacgtatgatgccttattccgaaagtctgaaagatactttagttcgagtgata
ccattttggacagatcatatttcacaatatttgctagatggtcaaacggtattagtttct
gcacacggaaattcaattcgcgcattgattaaatatcttgaagatgtgtcagatgaagat
atcattaattatgaaattaaaacaggtgcaccgcttgtttatgaattaacggatgattta
gaagttatagataaatactacttataa

DBGET integrated database retrieval system